KEGG   Papaver somniferum (opium poppy): 113322152
Entry
113322152         CDS       T05758                                 

Definition
(RefSeq) methyltetrahydroprotoberberine 14-monooxygenase-like
  KO
K22094  (S)-1-hydroxy-N-methylcanadine 13-hydroxylase [EC:1.14.14.163]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00950  Isoquinoline alkaloid biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Module
psom_M00946  Noscapine biosynthesis, (S)-reticuline => noscapine
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    113322152
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:psom00199]
    113322152
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.163  (S)-1-hydroxy-N-methylcanadine 13-hydroxylase
     113322152
Cytochrome P450 [BR:psom00199]
 Cytochrome P450, plant type
  CYP82 family
   113322152
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 113322152
NCBI-ProteinID: XP_026425975
Position
11
AA seq 554 aa
MKSLMMNKLLFLQRITDSPSTTIISTFIVTIISIVFLYTVLLIRTTKNKQKIAAPKASGA
WPFIGHLKLFMKQDTQFYRTLGTMSDKYGSVFTLRLGNQAILVVSNWEMVKECFTTNDKS
FSNRPSTLSTKYMLNDTNSVVFSPYGTYWREMRKILVQKLLISNQRSEALKNLKTKEIDN
SFVKLNDLCNNDVSGGGTKVRMDEWLADMMFNIIARITFGYQSGGGDAPGASTTSKNVER
YKKTLDEMFVVLATRFAVSDIFPSLEFIDRLRGLVKDMKILGDELNSIAGCFIEEHRQKR
RESLSSLLSLSNESVGDEQDFIDVLLSIMDQSRLPGDDPDFIIKIMILEAFAGGTDSLSA
TLTWVLSLLLNHPNVLKRAREEIDRHVENGKQVEVSDIPKLGYIDAIIKETMRLYPVGAL
SERYTTEECEVGRFNVPAGTRLLVNIWKIHRDPSVWENPSDFQPERFLCSDKVGVDLYGQ
NYELIPFGAGRRVCPAIVSSLQTMHYALARLIQGYEMKSASLDGKVNMEEMIAMSCHKMS
PLEVIISPREPRRS
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaagtcgttaatgatgaacaagttattatttctccaacggattactgattctccttcg
accaccattatcagtacttttattgttacaataatatccattgtttttctctacactgtc
ttgttgataaggacgactaagaataagcagaagatagcagcaccaaaagcatcgggggcg
tggccgttcataggtcatctcaaactattcatgaaacaagatactcagttttacagaact
ctaggaaccatgtctgataaatacgggtcggtgttcacacttcgattaggaaaccaagca
atcctagttgtgagcaactgggagatggtaaaagaatgtttcacaacaaacgacaagtca
ttctcgaatcgtccaagtacgttaagcactaaatacatgctgaatgacactaattctgtc
gtgttttcaccttacggaacgtattggagagaaatgcggaagatattggtgcaaaaacta
ctgatctctaaccaaagatcagaggcattgaaaaatctgaaaacgaaagaaatcgacaac
tcgtttgtaaagcttaatgatttatgcaacaacgatgtcagtggaggaggcacaaaagtt
aggatggacgaatggttggctgacatgatgttcaacattattgctaggattacatttggt
taccaaagcggaggaggcgatgcacctggcgcttctacaacatccaagaatgtcgagaga
tacaagaaaacgttggacgagatgtttgttgttttagcgacgaggtttgcagtttcagat
atatttccatctctggagtttatagaccgattgagaggtcttgtaaaggatatgaaaatc
ttgggagacgaattaaactccattgctggatgttttattgaagaacatcgtcaaaagaga
cgagaatcattatcctcattgttatctttgtcaaatgaatccgttggtgatgaacaagat
ttcattgatgttctcttgtcaataatggatcagtcacggcttcccggagatgacccagat
tttattatcaaaattatgatcctggaagcttttgcaggtgggacggacagtttaagtgca
accttaacttgggtcctctctctactgctgaaccacccaaacgtgttaaagagggcaagg
gaggaaatagataggcatgtggaaaacggtaagcaagtggaagtgtctgatattccgaag
ctcggatacattgatgcaataatcaaagagacgatgagattgtatccagtcggagcatta
agcgaacgatacacgactgaagaatgcgaggttggtcggtttaacgtacccgctggcaca
cgcttactggtgaatatatggaagatccacagagacccaagtgtgtgggagaatccatca
gattttcaaccagagaggtttttgtgcagcgataaggtgggtgtggatttatatggccag
aattatgagctgataccatttggggccggtaggagggtatgtccggctatagtttcatca
ctgcagacgatgcattatgcgttggcgcgtcttattcaaggatatgaaatgaaatcagcc
agcctcgatgggaaggtgaatatggaagaaatgatagccatgtcgtgccacaagatgagc
cctcttgaagttattatcagtcctcgggagccgaggcggagttaa

DBGET integrated database retrieval system