KEGG   Pseudomonas sp. Os17: POS17_5138
Entry
POS17_5138        CDS       T04177                                 
Symbol
pcuC
Name
(GenBank) p-hydroxybenzaldehyde dehydrogenase
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00623  Toluene degradation
psos01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psos00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    POS17_5138 (pcuC)
Enzymes [BR:psos01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     POS17_5138 (pcuC)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BAQ76832
UniProt: A0A0D6BP11
Position
5743843..5745318
AA seq 491 aa
MTATRPAYQHLELQPIAGQWRAGSSGQALAVLDPFTEQCLLQISLANRQDLDQAYTKARQ
TQAPWAASAPAQRSQVLLNAARIFDERREEIIGWLVRESGSTRIKAQIEWGAARAIIVEA
ASLPSRVHGRIVASNVPGKESRVYRKPLGVIGVISPWNFPLHLSARSLAPALALGNAVVI
KPASDTPVTGGLLLARIFEEAGLPAGVLSVVVGTGAEIGDAFVEHPVPAFISFTGSTQVG
RNIGRIASGGAHLKHVALELGGNSPFVVLADADLEQAVNAAVVGKFLHQGQICMAINRII
VEQPVLQAFTQRFVERVKALPHGDPNLPATVVGPVINHKQLAGLQDKISLALSEGATLLV
GGPASGNVLPPHVFGDVRADMEIAREEIFGPLVGIQSARDAEHALELANASEYGLSSAVF
SANPERGVQFAQRLHAGMSHVNDMPVNDEPNAPFGGEKNSGLGRFNGDWAIDEFTTDHWI
TLQHTPRPYPF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgactgcgactcgacctgcctatcaacacctggaactgcagcccatcgccggacaatgg
cgcgccggcagcagcggccaagcgctggccgtcctcgacccgttcaccgagcaatgcctg
ctgcagatcagcctggccaaccgccaggacctcgaccaggcctacaccaaggcccgccag
acccaggccccatgggccgccagcgcgcctgcccaacgcagccaagtgctgctcaacgcc
gcgcggatcttcgatgagcgccgcgaggaaatcatcggctggctggtccgcgagtccggc
agtacccggatcaaggcgcagatcgaatggggcgcggcccgcgccatcatcgtcgaagcg
gccagcctgcccagccgggtccacgggcggatcgtcgcctccaacgtccccggcaaggaa
agccgcgtctaccgcaagcccctgggggtgatcggggtgatcagcccctggaacttcccc
ctgcacctgagcgcccgctccctggcgccggccctggccctgggcaacgcggtggtgatc
aagcccgccagcgacaccccggtgaccggcggcctgctgctggcgcggatcttcgaggaa
gccggcctgcccgccggggtgctcagcgtggtggtcggcaccggggcggaaatcggcgat
gcctttgtcgagcacccggtgccggcgttcatttccttcaccggctcgacccaggtcggc
cgcaacatcgggcgcatcgccagtggcggcgcgcacctcaagcatgtggccctggaactg
gggggcaacagcccgttcgtggtcctggccgatgccgacttggaacaggcggtgaacgcc
gcggtggtgggcaagttcctgcaccaggggcagatctgcatggcgatcaaccgcatcatc
gtcgaacagccagtgctgcaagcctttacccaacgctttgtcgaacgggtcaaggccctg
ccccatggcgacccgaatctgccggccacggtggtcggcccggtgatcaaccacaaacag
ctggccggtctgcaagacaagatcagcctggccctgagcgaaggcgcgaccttgctagtg
ggtggcccggcttcgggcaacgtgctgccacctcacgtgttcggcgacgtccgcgccgac
atggagattgcccgcgaagaaatcttcggccccctggtgggcatccagagcgcacgggat
gccgagcacgccctggagctggccaatgccagtgaatacggcctgtccagcgcggtgttc
agcgccaacccggagcgtggcgtgcagttcgcccaacgcctgcacgcgggcatgagccac
gtcaacgatatgcccgtcaacgacgagcccaacgcgccctttggcggtgaaaagaactcg
ggcctgggccgcttcaacggcgactgggcaatcgatgaattcaccaccgaccactggatc
accctgcaacacacaccgcgcccctatccgttctga

DBGET integrated database retrieval system