KEGG   Phytohabitans suffuscus: Psuf_058140
Entry
Psuf_058140       CDS       T06545                                 

Definition
(GenBank) hypothetical protein
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
psuu  Phytohabitans suffuscus
Pathway
psuu00523  Polyketide sugar unit biosynthesis
psuu01100  Metabolic pathways
psuu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psuu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Psuf_058140
Enzymes [BR:psuu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     Psuf_058140
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran Methyltransf_15 TPMT Bin3 CMAS DUF938
Other DBs
NCBI-ProteinID: BCB88501
UniProt: A0A6F8YRN8
Position
6268979..6269710
AA seq 243 aa
MEYGAQHAALYDAAFHSRGKDYPGEAAAIVELVRQRRPEARTLLDVACGTGLHLRTFAAE
FDEVEGVELSPAMLDIARRRLPGVPLRAGDMRTFDLGRTFDAVTCVSNAVAEVETREGLA
LALRRMAAHLAPGGVLVVEPWYFPENYLDGYVGGHVFRDGDRVVSRVTHSTRHGDTTRHT
VAFMVATPAGITQFTDVCVLGLFTREEYLDALADAGVKAELVPGFSLADGRPNGPGLFVG
TRS
NT seq 732 nt   +upstreamnt  +downstreamnt
atggagtatggggcacagcacgccgcgctctacgacgcggcgttccacagccggggcaag
gactaccccggcgaggccgccgcgatcgtcgagctagtccggcagcggcgtcccgaggcc
cgcacgctgctggacgtggcctgcggcaccggcctgcacctgcggaccttcgccgcggag
ttcgacgaggtcgagggcgtcgagctctcgccggcgatgctcgacatcgcgcggcggcgg
ctgccgggggtaccgctgcgcgcgggcgacatgcgcaccttcgacctgggccgtacgttc
gacgcggtcacctgcgtctcgaacgcggtggccgaggtggagacccgcgaagggctggcg
ctggcgctgcgccggatggcggcccacctggcgccgggcggggtgctcgtcgtcgagccc
tggtacttcccggagaactacctcgacggctacgtcggcgggcacgtcttccgggacggc
gaccgggtcgtctcccgggtcacccactccacccggcacggcgacaccacgcggcacacg
gtggccttcatggtggccacgccggcggggatcacgcagttcaccgacgtctgcgtgctc
ggcctgttcacccgcgaggagtacctggacgcgctcgccgacgccggcgtgaaggcggag
ctggtgcccgggttcagcctcgccgacggccggccgaacggccccggcctcttcgtcggc
acgcggtcctga

DBGET integrated database retrieval system