KEGG   Phytohabitans suffuscus: Psuf_058430
Entry
Psuf_058430       CDS       T06545                                 

Definition
(GenBank) hypothetical protein
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
psuu  Phytohabitans suffuscus
Pathway
psuu00523  Polyketide sugar unit biosynthesis
psuu01100  Metabolic pathways
psuu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psuu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Psuf_058430
Enzymes [BR:psuu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     Psuf_058430
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 MetW Ubie_methyltran NodS NNMT_PNMT_TEMT
Other DBs
NCBI-ProteinID: BCB88530
UniProt: A0A6F8YQV9
Position
complement(6299290..6300057)
AA seq 255 aa
MSAAEPAARPDYSAYRAPLSQVYDLVYLGRGKDFVGEAKLVADLVRTRRPGASSLLDVGC
GTGEHLLTWRTMFTHVEGVDVSPDMLAVARAKLPGVPIHLGDMRDFDLGHTVDGICTLFS
TLAYMPSTADLDAAVANLARHLTIGGVLVAEPWWFPERFLSGHIGHDVVREDGATVARVV
RTTTVEGTAHLEAHYVVADREGIRGFVHVQRFTLFDHADYRDAFQRAGCDVEYIPGPSTL
ATGTGRGLFVGVRRR
NT seq 768 nt   +upstreamnt  +downstreamnt
gtgagcgccgccgagccagcggcccggccggactacagcgcgtaccgggcaccgctgagc
caggtgtacgacctggtctacctcggccggggcaaggacttcgtgggcgaggcgaagctg
gtcgccgacctcgtccggacccgccggcccggggcgtcctcgctgctcgacgtcggctgc
ggcaccggcgagcacctgctcacctggcgcaccatgttcacgcacgtcgagggcgtcgac
gtctcgcccgacatgctcgccgtggcccgcgccaagctgcccggcgtgccgatccacctc
ggcgacatgcgcgacttcgacctcggccacaccgtcgacgggatctgcaccctgttcagc
acgctggcctacatgccctccaccgccgacctggacgccgcggtcgccaacctggcccgc
cacctgacgatcggcggcgtcctggtggccgagccgtggtggtttcccgagcggttcctt
tccggccacatcggacacgacgtggtacgcgaggacggcgcgacggtggcccgggtcgtg
cgcaccaccacggtcgagggcaccgcccacctcgaggcccactacgtcgtggccgaccgg
gagggcatccgcggcttcgtacacgtgcaacggttcaccctcttcgaccacgccgactac
cgcgacgccttccagcgggccggctgcgacgtcgagtacatcccaggccccagcactctc
gccaccggcaccggccgcggcctgttcgtcggcgtccgccgccggtag

DBGET integrated database retrieval system