KEGG   Pseudomonas sp. VLB120: PVLB_26567
Entry
PVLB_26567        CDS       T02897                                 

Definition
(GenBank) hypothetical protein
  KO
K18312  styrene-oxide isomerase [EC:5.3.99.7]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00643  Styrene degradation
psv01100  Metabolic pathways
psv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    PVLB_26567
Enzymes [BR:psv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.7  styrene-oxide isomerase
     PVLB_26567
SSDB
Other DBs
NCBI-ProteinID: AGZ38050
UniProt: O50216
Position
pSTY:133317..133826
AA seq 169 aa
MLHAFERKMAGHGILMIFCTLLFGVGLWMNLVGGFEIIPGYIIEFHVPGSPEGWARAHSG
PALNGMMVIAVAFVLPSLGFADKTARLLGSIIVLDGWSNVGFYLFSNFSPNRGLTFGPNQ
FGPGDIFSFLALAPAYLFGVLAMGALAVIGYQALKSTRSRKAVPHAAAE
NT seq 510 nt   +upstreamnt  +downstreamnt
atgcttcatgccttcgaacgcaaaatggccggccacggcatcctgatgatcttctgcacc
cttctatttggtgttggtctttggatgaacttggttggcggctttgaaatcatcccggga
tacatcatcgagtttcatgtcccgggttcccctgagggctgggcgagggctcattccggc
cccgcactgaatggaatgatggtgatagcagtggcattcgttttgcccagccttggcttc
gccgataagacggcgcgcttgctgggcagcattatcgtcctggacggttggtcgaacgtc
ggtttctaccttttctccaacttctctcccaatcgtggcctgaccttcggccccaaccaa
tttgggcctggcgatatcttcagcttcctcgccctggctcccgcctatctgtttggtgtt
ctcgcaatgggggcgctcgcagtgatcggctaccaggcattgaagagcacccgttctcgt
aaagctgttccgcacgctgctgcggaatga

DBGET integrated database retrieval system