KEGG   Paraburkholderia terrae: C2L65_19195
Entry
C2L65_19195       CDS       T05318                                 

Name
(GenBank) 2,4,6-trichlorophenol monooxygenase
  KO
K24293  3,5,6-trichloropyridin-2-ol/2,4,6-trichlorophenol monooxygenase [EC:1.14.14.172 1.14.14.173]
Organism
pter  Paraburkholderia terrae
Pathway
pter00361  Chlorocyclohexane and chlorobenzene degradation
pter01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    C2L65_19195
Enzymes [BR:pter01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.172  3,5,6-trichloropyridin-2-ol monooxygenase
     C2L65_19195
    1.14.14.173  2,4,6-trichlorophenol monooxygenase
     C2L65_19195
SSDB
Motif
Pfam: HpaB_N HpaB
Other DBs
NCBI-ProteinID: AUT61823
UniProt: A0A2I8EQC2
Position
2:complement(674066..675619)
AA seq 517 aa
MIRTGKQYLDSLNDGRDVWVGNDKIDNVATHPKTRGYAKVHADFYDLHHREDLRDVLTFV
DEDGERRSMQWFSHRDKDALRRKRKYHETIMRELAGASFPRTPDVNNYVLVTYADDPAPW
EEQAIGAEGKGLANNIVEFVKRAKHNDFNCAPQFVDPQMDRSRPDAQEKSPGLRVVKKDE
HGITVDGVKAIGTGVAFADWIHIGVFFRPGIPGDQIIFAATPVNTKGVTIVCRESAVKDD
ATEHPLAAQGDELDGMTVFDNVFIPWSQVFHIGNPEHAKLYPQRVFDWLHYHALIRQVVR
AELMAGLAVLITEHIGTNKIPQVQTRVAKLIGFHQAMLAHMIASEELGFHTPGGHYKPNI
LIYDFGRAYYLENFSTMIYELVDLCGRSALIFPTEAQWKDVKLGPWLERMNSGPTGKPYD
RVKIGRVVRDLFLSDWGSRLFMFENFNGTPLQAIRSLTMQRAEFSGSGPYGKLASKVCGI
DHRNELMTEYAASADYAKAQDSARHQEQLATHSALTV
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgatccgcactggcaagcagtatctcgactcattgaacgacggacgcgacgtctgggtc
ggcaacgacaagatcgacaacgtcgccacccatccgaaaacgcgcggctacgcgaaagtt
cacgccgacttctacgatctgcaccatcgcgaagatcttcgggacgtgctgacgttcgtc
gacgaagacggcgagcgccgttcaatgcagtggttcagtcatcgcgacaaggacgccttg
cgccgcaaacgcaaatatcacgaaacgatcatgcgcgaactggcgggcgcgtcgttcccc
cgcacgccggacgtcaacaactatgtgctggtgacctacgccgacgatcccgcgccttgg
gaagaacaggccatcggcgcagaaggcaaaggtctcgccaacaatatcgttgagttcgtg
aagcgtgcgaagcacaacgacttcaactgcgccccgcaattcgtcgatcctcaaatggac
cgctcgcgtcctgacgcgcaggagaagtcgccgggactgcgcgtcgtgaagaaagacgag
cacggcattacagtcgatggcgtcaaggcgatcggcacgggtgtggcctttgccgactgg
attcacatcggcgtgttcttccgccccggcattcccggcgaccagatcatcttcgccgcc
acgcccgtgaacacgaaaggcgtgacgatcgtgtgccgcgaaagtgccgtgaaggacgac
gcgaccgaacacccgctcgccgcgcaaggcgacgaactcgatggcatgaccgtgttcgac
aacgtcttcattccgtggagccaggtgttccatatcggcaatccggaacacgcgaagctg
tatccgcaacgcgtgttcgactggctgcactatcacgcgctgatccgtcaagtcgtgcgt
gccgaactcatggcaggtctcgccgtgctgatcaccgagcacatcgggaccaacaagata
ccgcaggtgcagacgcgtgtcgcgaagctgattggcttccatcaggcgatgcttgcacac
atgatcgccagcgaggaactcggttttcatacaccgggcggtcactacaagccgaacatc
ttgatctatgacttcggccgcgcgtactacctcgaaaacttctccacgatgatctacgag
ctggtggacctgtgcggccgcagcgcgctgattttcccgacggaagcgcaatggaaggac
gtcaagctcggcccgtggctcgaacgcatgaacagtgggccgacgggcaagccgtacgac
cgcgtgaagatcggccgtgtggtgcgcgatctgttcctgtccgactggggcagccgcctg
ttcatgttcgagaacttcaacggcacgccgctgcaggccatccgctcgctcacgatgcag
cgcgccgagttctctggctcgggcccctacggcaagctcgcctcgaaagtgtgcggcatc
gatcaccgcaacgaattgatgactgaatatgcggcctccgctgactatgcgaaggcacag
gattccgcgcgtcatcaggaacaactcgcgacccacagcgcgttgaccgtctaa

DBGET integrated database retrieval system