Paenibacillus tianjinensis: JRJ22_11260 Help Entry JRJ22_11260       CDS       T07842                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ptj  Paenibacillus tianjinensis Pathway ptj02024   Quorum sensing ptj03018   RNA degradation Brite KEGG Orthology (KO) [BR:ptj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     JRJ22_11260 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     JRJ22_11260 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ptj03019]     JRJ22_11260 (hfq)    03036 Chromosome and associated proteins [BR:ptj03036]     JRJ22_11260 (hfq) Messenger RNA biogenesis [BR:ptj03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      JRJ22_11260 (hfq) Chromosome and associated proteins [BR:ptj03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     JRJ22_11260 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Flag1_repress Motif Other DBs NCBI-ProteinID:  QSF47089 Position complement(2565829..2566050) Genome browser AA seq 73 aa AA seqDB search MESLKLQERLLNQCISTKVPVTIFTTNGVKMQGLVTSYDAYTITLQGQGDGRQNVLFKSA VSTIVPLKPVSLK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gtggaaagtctaaaattacaggaacgtttgttgaaccagtgtatttcaacaaaggtgccc gtgacgatttttacaaccaatggggtcaagatgcagggactcgttacctcatatgacgct tatacaattactctgcagggccagggtgatggcagacagaacgttttgttcaaatctgcg gtctcgacaatcgtgccgttaaagcccgtctcgcttaaataa

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (3) Pfam (3) All databases (4) Download RDF

DBGET integrated database retrieval system