KEGG   Pan troglodytes (chimpanzee): 449624
Entry
449624            CDS       T01005                                 

Gene name
KLRC3
Definition
(RefSeq) NKG2-E type II integral membrane protein
  KO
K24233  killer cell lectin-like receptor subfamily C2/3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04612  Antigen processing and presentation
ptr04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    449624 (KLRC3)
   04612 Antigen processing and presentation
    449624 (KLRC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptr04090]
    449624 (KLRC3)
   04091 Lectins [BR:ptr04091]
    449624 (KLRC3)
CD molecules [BR:ptr04090]
 Proteins
  449624 (KLRC3)
Lectins [BR:ptr04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   449624 (KLRC3)
SSDB
Motif
Pfam: Lectin_C UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 449624
NCBI-ProteinID: NP_001009017
Ensembl: ENSPTRG00000029781
UniProt: Q95MI4
Position
12
AA seq 240 aa
MNKQRGTFSEVSLAQDPKRQQRKPKGNKSSISATEQEIFQVELNLQNASLNHQGIDKIYD
CQGLLPPPEKLTAKMLGIICIVLMSAVLKTIVLIPFLEQNNSSPNTRTQKARPCGHCPEE
WITYSNSCYYIGKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPSSWIGVFCNS
SHHPWVTINGLAFKHEIKDSDHAERNCAMLHVCGLISDQCGSSRIIRRGFIMLTRLVLNS
NT seq 723 nt   +upstreamnt  +downstreamnt
atgaataaacaaagaggaactttctcagaagtgagtctggcccaggacccaaagcggcag
caaaggaaacctaaaggcaataaaagctccatttcagcaaccgaacaggaaatattccaa
gtagaattaaaccttcaaaatgcttctctgaatcatcaagggattgataaaatatatgac
tgccaaggtttactgccacctccagagaagctcactgctaagatgctgggaatcatttgc
attgtcctgatgtctgctgtgttaaaaacgatagttcttattcctttcctggagcagaac
aattcttccccaaatacaagaacccagaaagcacgtccttgtggccattgtcctgaggag
tggattacatattccaacagttgttattacattggtaaggaaagaagaacttgggaagag
agtttgcaggcctgtgcttcaaagaactcttctagtctgctttctatagataatgaagaa
gaaatgaaatttctggccagcattttaccgtcctcatggattggtgtgttttgtaacagc
agtcatcatccgtgggtgacaataaatggtttggctttcaaacatgagataaaagactca
gatcatgctgaacgtaactgtgcaatgctacatgtatgtggacttatatcagaccagtgt
ggttcttcaagaatcattagacggggtttcatcatgttgaccaggctggtcttgaactcc
tga

DBGET integrated database retrieval system