KEGG   Pan troglodytes (chimpanzee): 463582
Entry
463582            CDS       T01005                                 

Symbol
CYP3A4
Name
(RefSeq) cytochrome P450 family 3 subfamily A member 4
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00140  Steroid hormone biosynthesis
ptr00591  Linoleic acid metabolism
ptr00830  Retinol metabolism
ptr00980  Metabolism of xenobiotics by cytochrome P450
ptr00982  Drug metabolism - cytochrome P450
ptr00983  Drug metabolism - other enzymes
ptr01100  Metabolic pathways
ptr04976  Bile secretion
ptr05204  Chemical carcinogenesis - DNA adducts
ptr05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    463582 (CYP3A4)
   00591 Linoleic acid metabolism
    463582 (CYP3A4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    463582 (CYP3A4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    463582 (CYP3A4)
   00982 Drug metabolism - cytochrome P450
    463582 (CYP3A4)
   00983 Drug metabolism - other enzymes
    463582 (CYP3A4)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    463582 (CYP3A4)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    463582 (CYP3A4)
   05207 Chemical carcinogenesis - receptor activation
    463582 (CYP3A4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ptr00199]
    463582 (CYP3A4)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     463582 (CYP3A4)
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     463582 (CYP3A4)
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     463582 (CYP3A4)
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     463582 (CYP3A4)
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     463582 (CYP3A4)
    1.14.14.-  
     463582 (CYP3A4)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP3 family
   463582 (CYP3A4)
SSDB
Motif
Pfam: p450 Coa1
Other DBs
NCBI-GeneID: 463582
NCBI-ProteinID: NP_001116247
Ensembl: ENSPTRG00000033773
VGNC: 13644
UniProt: A0A6D2XJ66 B1NL93
Position
7
AA seq 503 aa
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYRKGFCMF
DMECHKKYGKVWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREADTGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIIVFPFLIPILEVLNICV
FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLRLG
GLLQPEKPIVLKVESRDGTVSGA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggctctcatcccagacttggccatggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatattttgtcctaccgtaagggcttttgtatgttt
gacatggaatgtcataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcctgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagacacaggcaagcctgtcaccttgaaagacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgattttttggatccattcttt
ctctcaataatagtctttccattcctcatcccaattcttgaagtattaaatatctgtgtg
tttccaagagaagttacaaattttttaagaaaatctgtaaaaaggatgaaagaaagtcgc
ctcgaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagaaactgagtcccacaaagctctgtccgatctggagctcgtggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatgtatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatcttgacatggtggtg
aatgaaacactcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgagatcaatgggatgttcattcccaaaggggtggtggtgatgattccaagctatgct
cttcaccgtgacccaaagtactggacagagcctgagaagttcctccctgaaagattcagc
aagaagaacaaggacaacatagatccttacatatacacaccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgcttagga
ggacttcttcaaccagaaaaacccattgttctaaaggttgagtcaagggatggcaccgta
agtggagcctga

DBGET integrated database retrieval system