KEGG   Paraburkholderia tropica: G5S35_15145
Entry
G5S35_15145       CDS       T07044                                 

Name
(GenBank) bifunctional 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase
  KO
K20943  resorcinol 4-hydroxylase (NADPH) [EC:1.14.13.219]
Organism
ptro  Paraburkholderia tropica
Pathway
ptro00362  Benzoate degradation
ptro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ptro00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    G5S35_15145
Enzymes [BR:ptro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.219  resorcinol 4-hydroxylase (NADPH)
     G5S35_15145
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox_2 DAO Pyr_redox HI0933_like NAD_binding_8 ApbA FAD_oxidored FAD_binding_2 NAD_Gly3P_dh_N 3HCDH_N SE
Other DBs
NCBI-ProteinID: QNB13008
UniProt: A0A7G6BCM4
Position
B:93750..95390
AA seq 546 aa
MNAPASSPHSRFDADVAIIGGGPVGTLLAILLGQRGKRVTLVERWSKAYGRPRAVTYDHE
IARILATLGIDSERDPAISYHDELYYWKDARGENLQIVDWQSQSASGWRVRYWFNQPDLE
ARLTRIVDGMPGVTQLRGWEGTELVQDRDSVTVSLRRTPQEVGEGGGDVDADADARVLRA
QYLVGADGANSFVREALGIENEDRGYFFDWLILDLIPREAYTAQPTQWQLCDPKRPTTIV
PGGPGRRRWEFMVLPGESAEELQTTRRAWELLAPWGMTPDNAELERSAVYRFQARWAKTW
HRGRCVIAGDAAHLMPPFAGEGMCAGLRDAFALGWRLNAMLEGRMSDAVLDSYTTERLEH
AKHYIEFSQALGKIICIANENEAAERDVKMKADLLARNHQPVPTDVCHLGPGAWSAGSAH
AGELSVQGVVEANGRRDRFDQAVGHGWFVIGLDADPAQALGPERLEQLALIEGRTARIAT
PGGANTACEALDIDSTYRHWLEKIEASYVVLRPDFYVAATASSAAQLRERFDEVIAKLHV
RVREVV
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgaacgcccccgcctcaagcccgcattcccgcttcgatgctgacgtcgccatcatcggc
ggcggccccgtcggtacgctgctcgcgatcctgctcggtcagcgcggcaaacgcgtcacg
ctggtcgagcgctggtcgaaggcgtacggccgcccgcgcgccgtcacctacgaccacgaa
atcgcccgcattctcgcgacgctcgggatcgactcggagcgcgatccggccatctcgtat
cacgacgagctgtactactggaaagacgcgcgcggcgagaatctgcagatcgtcgattgg
cagagccagtccgcgtcgggctggcgcgtgcgttactggttcaatcagcccgacctcgaa
gcgcggctcacgcgcatcgtcgacggtatgccgggcgtcacgcaattgcgtggatgggag
ggcacggagctggtccaggaccgcgacagcgtgacggtgtcgctcagacgcacgccgcag
gaagttggcgagggtggcggtgatgtcgatgccgatgccgatgcccgcgtgctgcgcgcg
cagtacctggtgggcgcggacggtgcgaacagcttcgtgcgcgaggcgctcggcatcgag
aacgaggaccgcggttatttcttcgactggctcattctcgacctcatcccgcgcgaggcc
tacaccgcgcagccgacgcagtggcaactgtgcgatccgaagcggccgacgacgatcgtg
cccggcggcccgggtcgtcgacgctgggagttcatggtcctgccgggcgagtcggccgag
gaattgcagacgacgcgacgcgcgtgggaactgctggcgccctggggcatgacgcccgac
aacgccgaactcgaacgcagcgcggtctatcgctttcaggctcgctgggcgaagacctgg
catcgcggccgttgcgtgattgcgggcgacgccgcgcatctgatgccgccgttcgcgggc
gagggcatgtgcgcggggttgcgcgatgcgttcgcgctcggctggcgtctgaacgcgatg
ctcgaaggccggatgtccgacgccgtgctcgacagttacaccacggaacgccttgaacac
gcgaagcattacatcgagttcagccaggcgctgggcaagatcatctgcattgcgaacgaa
aacgaggccgccgagcgcgacgtgaaaatgaaggccgatttgctggcacgcaaccatcag
ccggtgccgaccgatgtgtgccatctggggccgggcgcctggtccgccggatcggcgcat
gcgggcgagttgtcggtgcagggcgtggtcgaggcgaacgggcggcgcgaccgttttgat
caggctgtcgggcatggctggttcgtgatcggtctggatgccgatccggcgcaggcgctc
gggcccgagcggctggagcaactggcgctgatcgaaggccgcacggcgcgcatcgccacg
ccgggtggtgcaaatacggcttgcgaagcgctcgatatcgactcaacgtatcggcactgg
ctcgaaaaaatcgaggcaagctatgtcgtgctgcgccccgacttttacgtggcggccacg
gcgagcagcgcggcgcagttgcgtgagcgtttcgacgaagtcatcgcgaagctccatgtt
cgcgttcgcgaagtcgtttga

DBGET integrated database retrieval system