KEGG   Pseudomonas umsongensis: HGP31_12070
Entry
HGP31_12070       CDS       T06842                                 
Name
(GenBank) aldehyde dehydrogenase family protein
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
pum  Pseudomonas umsongensis
Pathway
pum00623  Toluene degradation
pum01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pum00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    HGP31_12070
Enzymes [BR:pum01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     HGP31_12070
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: QJC79007
Position
complement(2624862..2626346)
AA seq 494 aa
MTTTPFVRPAYQNLELQPLAGQWRAGSAGRTLDVFDPFTQTRLLQITQANREDLDAAYRK
ARVTQLDWATKGPAERGQVLLNAVKIFDERREEIIDWIIRESGSTRIKAQIEWGAARAIT
LESASLPSRVHGRILASNIPGKESRVYRTPLGVIGVISPWNFPLHLTARSLAPALALGNA
VVVKPASDTPVTGGLLLARIFEEAGLPSGVLSVVVGSGAEIGDAFVEHPVPAFISFTGST
QVGRNIGRIASGGEHLKHVALELGGNSPFVVLADADVEQAVSAAVVGKFLHQGQICMAIN
RIIVEQPLLETFTRRFVERVKALPYGDPNKAETVIGPVINSKQLAGLQEKIATAQAEGAT
LLVGGEAHGNVLPPHVFGNVTADMDIAHEEIFGPLVGIQSARDAEHALELANSSEYGLSS
AVFTSSLERGVQFARRIHAGMTHVNDIPVNDEPNAPFGGEKNSGLGRFNGDWAIDEFTTD
HWITLQHAPRAYPF
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaccactacccctttcgttcgccctgcctaccagaaccttgaattgcagccactcgcc
ggacaatggcgcgccggcagcgccggtcgaacgttggacgtgttcgaccctttcactcag
acacgcttgctgcagatcacccaggccaatcgcgaagacctcgatgccgcctaccgcaag
gcgcgcgtcacccagctcgattgggccaccaaagggccggccgaacggggccaggtgctg
ctcaacgcggtgaaaatcttcgacgagcgtcgtgaagaaatcatcgattggatcatccgc
gagtccggcagtacgcgcatcaaggcgcagatcgaatggggcgccgcgcgcgctatcacc
ctggagtcagccagcctgcccagccgcgtgcatgggcgcattcttgcctccaacatccct
ggcaaggaaagccgcgtctaccgcacccccctgggcgtgatcggtgtgatcagcccgtgg
aatttccccttgcacctgaccgcacgctccctcgcaccggccctggcgctgggcaacgcc
gtagtggtcaagccggccagtgacacccccgtcaccggcggcctgttgctggcgcgcatc
ttcgaggaagccggcttgccatctggcgtgctcagtgtcgtcgtcggttccggcgcggaa
atcggcgatgccttcgtcgagcacccggtcccggcgttcatctccttcaccggatcgacc
caggtcggccgcaacatcggccgcatcgccagcggcggtgagcatctgaagcacgttgcc
ctggaactgggtggaaacagtccgttcgtggtcctggccgatgccgacgtcgaacaggcc
gtcagtgccgccgtggtgggcaaattcctccaccaggggcaaatctgcatggcgatcaac
cgcatcatcgtcgaacagccgctgctggaaaccttcacccggcgattcgtcgagcgagtc
aaggcgctgccctacggcgacccgaacaaagctgaaacggtgataggcccggtgatcaac
agcaagcaactggcgggcctgcaagagaagatcgccacggcccaagccgaaggcgccacg
ctgctggttggcggtgaagcccacggcaacgtcctgccgccgcacgtgttcggcaacgtc
accgccgacatggacatcgcccatgaagaaatctttggccctctggtcggcattcagtct
gcccgtgacgccgagcatgccctggaactggccaacagcagcgaatacggactctccagc
gccgtattcacctccagcctggagcgcggcgtgcagttcgcccgacgcatccacgccggt
atgacccacgtcaacgacatcccggtcaatgacgaacccaacgcgccgttcggcggtgag
aagaactccgggctcggtcgcttcaacggcgattgggcgatcgacgagttcaccactgac
cactggatcaccttgcaacatgcgccaagggcgtatccgttctga

DBGET integrated database retrieval system