KEGG   Pusillimonas sp. T7-7: PT7_1103
Entry
PT7_1103          CDS       T01486                                 

Definition
(GenBank) hypothetical protein
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00626  Naphthalene degradation
put01100  Metabolic pathways
put01120  Microbial metabolism in diverse environments
put01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:put00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PT7_1103
Enzymes [BR:put01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     PT7_1103
SSDB
Motif
Pfam: DSBA DUF1062
Other DBs
NCBI-ProteinID: AEC19643
UniProt: F4GSQ1
Position
complement(1211945..1212544)
AA seq 199 aa
MQKKKVEIYWDVGSTNTYFALKLIKPILERHNAELVLHPFNLGYVFRNNNYELMKESKAK
LRNRKRDLMRWSEKYNIPFQIPRQFPIKSSRALRGSLAMRRHGLELEFVEAVLSLYWVQG
DASIAEYAGLRPIAQSLGVDPDEFERLSVSDEIGVELAASTDKGLERDVFGVPMIIVRDE
LFWGKDRMEFVEDELRRAG
NT seq 600 nt   +upstreamnt  +downstreamnt
atgcaaaaaaagaaggttgaaatatactgggatgttggcagcaccaatacctactttgcc
ttgaagttgatcaagccaatactcgagcgccacaatgcggagctggtactgcatccgttc
aatctgggctacgtctttcgcaataacaattacgaactcatgaaggagtccaaggcaaag
ctaaggaaccgcaagcgcgacttgatgcgctggtccgaaaagtacaacattccgttccag
attcccaggcagtttcccatcaagtccagcagggcgctgcgaggttcactggccatgcgt
cgacacggcttggagctcgaattcgtcgaggcggtcctgagtctctactgggtacaagga
gatgcctctatcgcggaatacgccggcttacgccccattgcacagtcgctgggtgttgac
ccagatgagtttgaacggcttagtgttagtgatgaaataggcgtagagctggcagcaagc
actgataagggccttgagcgcgatgtatttggtgtgccaatgatcattgtcagagatgag
ctgttctggggtaaagaccggatggagtttgttgaggatgagttgcgacgtgctggttaa

DBGET integrated database retrieval system