KEGG   Panicum virgatum (switchgrass): 120639519
Entry
120639519         CDS       T07260                                 

Name
(RefSeq) cytochrome P450 93G1-like
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
pvir  Panicum virgatum (switchgrass)
Pathway
pvir00941  Flavonoid biosynthesis
pvir01100  Metabolic pathways
pvir01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvir00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    120639519
   00943 Isoflavonoid biosynthesis
    120639519
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pvir00199]
    120639519
Enzymes [BR:pvir01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     120639519
Cytochrome P450 [BR:pvir00199]
 Cytochrome P450, plant type
  CYP93 family
   120639519
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 120639519
NCBI-ProteinID: XP_039771308
Position
7K:complement(1798986..1801049)
AA seq 534 aa
MQMEEQQGSSMAADPATAVLVALIAAAATAVALHHLLSWWRLQAPRLPPGPTSLPVIGHL
HLLRPPVHRTFQELASRVGPLIHIRLGSTHCVVASTAEVAGELIRSHEGSISERPLTAVA
RQFAYGSAGFAFAPYNAHWRFMKRLCMSELLGPRTVEQLRPVRRAGAVVLLRAALAASAR
GEAVDLTRELIRLANTSVIRMVASTVPGSVADEAQELVKAVAELVGAFNVDDYIALCRGW
DLQGLRRRAAAVHRRFDALLEEILRHKEEAREARRLLAADDDHRKAKDATTTHKDLLDIL
MDKAEDKTAEVKLTRDNIKAFIIDVVTAGSDTSAAMVEWMLAELMNHPEALRKVVAEIDA
VVGGGRIAGEADLPQLPYLMAAYKETLRLHPAAPIAHRQSSEAMVVRGFTVPPQTAVFIN
IWAIGRDPASWEEPLAFRPERFMPGGAAEGLEPRGQQFQFMPFGSGRRGCPGMGLALQSV
PAVLAALVQCFDWAAGGDGHQLIDMDESDGLVCARKQPLLLRPTPRLNPFPAVV
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgcaaatggaagagcagcagggcagcagcatggccgccgatccggcgaccgcagtccta
gtggcgctgatcgcggccgccgccaccgccgtggccttgcaccacctcctctcctggtgg
cgcctgcaggccccccggctgcccccgggcccgacgagcctcccggtgatcgggcacctc
cacctgctccggccgccggtccaccgcaccttccaggagctggcgtcccgcgtgggcccg
ctgatccacatccgcctgggctccacgcactgcgtggtggccagcaccgccgaggtggcc
ggcgagctgatccgctcccacgagggcagcatctcggagcggccgctcacggcggtggcg
cggcagttcgcctacggctcggcgggcttcgccttcgcgccctacaacgcgcactggcgc
ttcatgaagcgcctctgcatgtcggagctcctcggcccgcgcaccgtcgagcagctgcgc
cccgtccgccgcgccggcgccgtggtgctgctgcgcgccgcgctggcggcgtcggcgcgc
ggcgaggcggtggacctcacccgcgagctcatccgcctcgccaacacctccgtcatccgg
atggtcgccagcaccgtgcccgggagcgtcgccgacgaggcgcaggagctcgtcaaggcc
gtcgccgagctcgtcggcgccttcaacgtcgacgactacatcgccctctgccgcggctgg
gacctccagggcctccgccggcgggccgccgccgtccaccgccgcttcgacgcgctgctg
gaggagatcctcaggcacaaggaggaggccagggaggcgcggaggctcctcgcggccgac
gacgaccacaggaaggccaaggacgccacgacgacgcacaaggacctgctggacatcctc
atggacaaagccgaggacaagacggcggaggtgaagctcacacgggacaacatcaaggcc
ttcatcatcgacgtggtgaccgctgggtcggacacgtcggcggccatggtggagtggatg
ctggcggagctgatgaaccacccggaggcgctgcgcaaggtggtggcggagatcgacgcc
gtggtgggcgggggccggatcgccggcgaggcggacctgccgcagctgccgtacctgatg
gcggcgtacaaggagacgctgcggctgcacccggcggcgcccatcgcgcaccggcagtcg
tcggaggcgatggtggtgcgcggcttcaccgtgccgccgcagaccgccgtgttcatcaac
atctgggccatcgggcgcgacccggcctcctgggaggagcccctggcgttccggccggag
cggttcatgcccggcggcgccgccgaggggctggagccccgcgggcagcagttccagttc
atgccgttcggcagcggccgccggggatgccccggcatgggtctggcgctgcagtccgtg
ccggccgtgctggccgcgctcgtgcagtgctttgactgggccgccggtggcgacggccac
cagttgattgacatggatgagtcggacggcctggtgtgcgctcgcaagcaaccgctcctg
ctccgccccacacctcgcctcaacccattcccggccgtcgtctga

DBGET integrated database retrieval system