KEGG   Pseudomonas viciae: EPZ47_16295
Entry
EPZ47_16295       CDS       T07167                                 

Name
(GenBank) amino acid adenylation domain-containing protein
  KO
K16126  L-threonine---[L-threonyl-carrier protein] ligase [EC:6.2.1.70]
Organism
pvk  Pseudomonas viciae
Pathway
pvk01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:pvk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    EPZ47_16295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:pvk01008]
    EPZ47_16295
Enzymes [BR:pvk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.70  L-threonine---[L-threonyl-carrier protein] ligase
     EPZ47_16295
Polyketide biosynthesis proteins [BR:pvk01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Syringomycin synthetase
    EPZ47_16295
SSDB
Motif
Pfam: AMP-binding AMP-binding_C PP-binding
Other DBs
NCBI-ProteinID: QBZ90205
UniProt: A0A4P7PI24
Position
3750950..3752797
AA seq 615 aa
MPIKNTGGSVNPAPAPLTSGALLHEIFTARAREFPERTAVSDASRSLSYAQLDTASSKLA
ARLRQEGVQDGMLVGMCLPRGVDLVISLLGILKAGGAYVPVDPQYPGKRVEHIVRYSGLS
LVIGELADLPQSASVRVLPLADLLAGPDLAPLADSDRRHPDEAAAYVIYTSGSTGEPKGV
LVAHGNVSRLLESTQRSFAFNENDVWSMFHSIGFDFSVWEIWGALAHGGHVAVVPYEVSR
SPGDMRQWLADQGVTVLSQTPSAFRGLDEADRSAPAPLALRYVVFGGEALPATVLRPWVE
RHGDQKPALINMYGITEATVHTTFKRVLGQDLESAAMVSIGAPLDGWRLHLLDADQQPVP
QGNAGELYIEGAGVALGYLNRPTLNAERFVQLPGTSSRAYRTGDLLVLGDDGEYRYAGRC
DEQLKIRGFRIEPGEVEACLQTSPAIAAAHVVGHDYGEGDWRLVTYVVPSQGVDAWTEQT
RNEVAALVAASLPDYMRPSAYIALAQLPVTDHGKIDKARLPSPDSVPSSVEHASEPGLTE
QEQFVLKIWSDDIGLKNIGLNDDFFDFGGTSLALIRSLSTLKAHYRVNLDPGVLADGATA
KVLAGCIQRSLVQAH
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgccgattaagaacactggcggatcggtcaaccccgcgccagcccccctcacgtctggt
gcattgctgcatgaaatattcaccgcccgggcccgtgaattccccgagcgaaccgcggta
tccgacgcctcgcgctcattgagctatgcccaactcgacacggcgtcatcgaagctggcg
gcccggcttcgccaggaaggcgtccaggacggcatgctggtggggatgtgcctgccacgc
ggcgtcgacctggtcatcagcctgctgggcattctcaaggccggtggcgcttatgtcccg
gtcgacccgcagtaccctggcaagcgtgtcgaacacatcgttcgctacagtggcctgagc
ctggtgatcggcgaactggccgacctgccgcagagcgcgtccgtgcgcgtcctgcccctc
gccgatctactggccggtccggacctggcaccacttgccgacagcgaccgtcgccacccc
gacgaggccgcggcgtacgtcatctacacctccggctcaaccggggaacccaagggtgtc
ctggtcgcgcacggcaatgtcagccgtctgctggaaagcacccagcgttcgttcgccttc
aacgagaacgacgtctggtcgatgttccactccatcggtttcgatttttcggtctgggaa
atctggggcgccctcgcccacggcggccacgtagccgtagtgccttacgaggtgtcgcgc
tcgcccggtgacatgcgccaatggttggcggaccagggtgtgacagtcctgagccagaca
ccctcggcgttccgtggcctcgatgaagccgaccgctccgcccctgcccccctggcgctg
cgctatgtggtgttcggcggcgaggcgctaccggccaccgtgctgcgcccatgggtcgag
cgtcacggcgatcagaagccggccttgatcaacatgtacggcatcaccgaagccaccgtc
cacaccaccttcaagcgcgtgctcggccaggacctggaaagcgccgccatggtttccatc
ggcgcgccactggatggctggcgtttgcatctgctcgacgccgatcagcaaccggtgccc
caaggcaacgccggtgagctgtacatcgaaggtgccggtgtagcgctgggctacctgaat
cgccctaccctgaatgccgagcgcttcgtccagttgccgggcacctcgagccgtgcctat
cgcaccggagacctgctggtcctgggggatgacggcgagtaccgctacgccggacgttgc
gatgaacaattgaagatccgtggtttccggatcgagccgggagaagtcgaggcttgcctg
caaaccagcccggccatcgctgcggcccatgtcgtcggccacgattacggcgagggcgac
tggcgcctggtcacctacgtggtgccgtcccagggcgtcgacgcctggaccgaacagacc
cgcaacgaagtggccgcgctggtggccgccagtctgccggactacatgcgtccttcagcc
tacattgcattggcgcaattgccggtcacggaccacggcaagatcgacaaggcccgcctg
ccctcgcctgactcggtaccttcgagcgtggaacatgccagcgaacccggcctcactgaa
caggagcagttcgtgctcaagatctggtcggacgatatcggcctgaagaacattggcctg
aacgatgacttcttcgatttcggcggcacctccctggccctgatccgctcgctgagcacg
ctcaaggcccattaccgggtcaacctcgacccaggcgtgctggcagatggcgcgaccgcc
aaggtattggccggttgcatccagcgttcccttgttcaagcccattga

DBGET integrated database retrieval system