KEGG   Pseudomonas viciae: EPZ47_21960
Entry
EPZ47_21960       CDS       T07167                                 

Name
(GenBank) FAD-dependent oxidoreductase
  KO
K20169  nicotine oxidoreductase [EC:1.5.3.-]
Organism
pvk  Pseudomonas viciae
Pathway
pvk00760  Nicotinate and nicotinamide metabolism
pvk01100  Metabolic pathways
pvk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pvk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    EPZ47_21960
Enzymes [BR:pvk01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.-  
     EPZ47_21960
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_oxidored Pyr_redox_2 FAD_binding_2 HI0933_like Thi4 GIDA FAD_binding_3 Lycopene_cycl
Other DBs
NCBI-ProteinID: QBZ91250
UniProt: A0A4P7PK57
Position
complement(4981355..4982803)
AA seq 482 aa
MSDKTKTNEGFSRRSFIGSAAVVTAGVAGLGAIDAASATQKTNRASTVKGGFDYDVVVVG
GGFAGATAARECGLQGYRTLLLEARSRLGGRTFTSRFAGQEIEFGGAWVHWLQPHVWAEM
QRYGLGVVEDPLTNLDKTLIMYNDGSVESISPDEFGKNIRIAFEKLCHDAWEVFPRPHEP
MFTERARELDKSSVLDRIKTLGLSRLQQAQINSYMALYAGETTDKFGLPGVLKLFACGGW
NYDAFMDTETHYRIQGGTIGLINAMLADSGAEVRMSVPVTAVEQVNGGVKIKTDDGEIIT
AGVVVMTVPLNTYKHIGFTPALSKGKQRFIKEGQLSKGAKLYVHVKQNLGRVFAFADEQQ
PLNWVQTHDYSDELGTILSITIARKETIDVNDRDAVTREVQKMFPGVEVLGTAAYDWTAD
PFSLGAWAAYGVGQLSRLKDLQAAEGRILFAGAETSNGWHANIDGAVESGLRAGREVKQL
LS
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgagtgataaaacaaaaacaaatgaaggctttagccgcaggtcttttatcggaagcgcg
gcagtcgtaacagcaggtgttgcgggattgggagctattgatgcggcttcggctacgcaa
aaaacgaaccgagcaagcaccgtcaaaggtggcttcgattacgatgtggtagtagttggt
ggagggtttgctggcgcgacagccgcccgtgaatgtggtttgcagggttatcgaacgctt
ttattggaagcgaggtcccgcctaggtggtcgtacgtttacctcgcgctttgcaggtcaa
gaaattgaatttggcggggcatgggtgcactggctgcagccgcatgtttgggcagaaatg
cagcgttatggtctgggtgtagtggaagatccacttactaatttagataaaaccttgatc
atgtataacgacggaagcgtcgagagtatttcgcccgatgaatttggcaaaaacattcga
atagcttttgaaaagctttgtcacgatgcctgggaagtatttcctcgtccgcatgagccg
atgtttactgagcgcgctcgggaattggataaatcttctgttcttgatcgcatcaaaact
ttgggcttaagtcggctgcaacaggctcaaatcaatagttacatggccttgtatgcaggt
gaaacaactgacaaatttggcctgcctggtgtacttaagttgtttgcatgcggcggttgg
aactatgacgccttcatggacactgaaactcattatagaattcaagggggcacgataggc
ctcattaatgcaatgttggccgatagcggtgccgaggtccgcatgtctgtgcccgtcact
gctgttgagcaagtcaatggtggcgtcaaaatcaagaccgacgacggcgaaattattacc
gccggagtggtcgtaatgacagttccactcaatacgtataaacatatcggttttacgcct
gccctttctaaaggtaaacaacgattcatcaaagaggggcagcttagcaaaggtgctaag
ctttatgttcatgttaagcagaatctcggacgggtttttgcgtttgcggatgaacagcaa
cctttaaactgggtccagacgcacgattacagcgacgagttggggacaatactgtcgatc
accatcgctcgcaaagaaacaattgatgtgaatgaccgagatgctgtaactcgcgaagtt
caaaaaatgtttccgggtgttgaggttcttggtacagcggcttacgactggacagctgat
ccattttccttgggggcatgggcggcttatggagtaggtcaactaagtcgtctcaaagat
ctacaggcggctgaaggacgtattttatttgcaggagctgaaaccagtaacggttggcac
gcgaatatcgatggtgctgttgagagtggactacgtgccggtagggaggttaagcagctc
ttaagctag

DBGET integrated database retrieval system