KEGG   Phaseolus vulgaris (common bean): PHAVU_004G104200g
Entry
PHAVU_004G104200g CDS       T03093                                 

Name
(RefSeq) hypothetical protein
  KO
K13263  isoflavone 7-O-glucosyltransferase [EC:2.4.1.170]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00943  Isoflavonoid biosynthesis
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    PHAVU_004G104200g
Enzymes [BR:pvu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.170  isoflavone 7-O-glucosyltransferase
     PHAVU_004G104200g
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 18632632
NCBI-ProteinID: XP_007152123
UniProt: V7C1R4
Position
4
AA seq 458 aa
MKDTIVLYPNIGRGHLVSMVELGKLILSHHPSLSITILILTPSPNATVTLACNSNAQYIA
ARPLAHLPLDTPSLPPHLISLELSRHSTQNVALALQSLAKVSNLKALVMDFLNFSNPKTL
TENLNTDIPTFFYFTSAAFSLVVLFHFGTTLPKQVQEQTFQLNFPGLPALSIDDLPNESR
DPLSHSSQIFSQIQESMKGSSGIIINTCEAMEEKAIAALNNDRTMPPLFCVGPVISEPYG
EEDKGCLSWLESQPSQSVVLLCFGSMGRFSTKQLMEIAIGLEQSEQRFLWVVRTELEGSD
SVEEKPSLNELLPEGFLERTKEKGYVVRDWAPQMEILSHHSVGGFVTHCGWNSVLEAVSE
GVPMVAWPLYAEQKLNRVLMVQEMKVALAVKEEKDGFVSRTELGERVRELMESETGKDIR
QRVFKMKLSAAEALVEGGTSRVALDKLAKLWKSSCFTI
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaaggataccattgttctgtaccctaacataggtaggggacacctagtctccatggtg
gagctcggcaagctcattctctcccaccacccttcgctttccatcaccatcctcatcctc
accccatcccccaacgccactgtcactctagcctgcaactccaacgcccaatacatcgcc
gcccgtcccctcgcccatctccccctcgacaccccttccctcccccctcacctcatctcc
ctcgaactctcccgccacagcacccaaaacgttgcccttgcactgcaatccctcgccaaa
gtatccaacctcaaagccctagtcatggacttcttaaacttcagcaaccccaaaaccctc
actgaaaatctaaacacagacatccccactttcttctacttcacttccgcagccttcagc
ctcgttgtgctctttcatttcggcaccactctcccaaaacaggtacaagaacaaacgttt
caacttaatttcccagggttacctgcactctccatcgatgatcttccgaacgaatcccgc
gaccctttgagccacagtagtcagattttcagtcagatacaggaatccatgaagggtagt
tctgggattataataaacacgtgcgaagcgatggaagagaaagccattgcggcgttgaac
aatgataggaccatgccaccgcttttttgtgttggtcccgtgatttctgaaccatacggg
gaagaagacaaagggtgtctgagttggctcgagtcacaaccaagtcagagcgtcgtgttg
ctgtgtttcggaagcatggggaggttctcgacgaagcagttgatggagatagcaattggg
ttggagcagagcgagcaaaggttcttgtgggtcgtgaggaccgaattggaaggcagtgac
tcggtggaggagaaaccgagtctgaacgagttgttgccagaaggatttttggaaaggacg
aaggagaaggggtatgtggtgcgggactgggccccacagatggagattctgagtcaccac
tcggtgggggggttcgtgactcactgcgggtggaactcggtgctggaagccgtgtccgaa
ggggtgccaatggtggcgtggccactgtacgcggagcagaagctgaatagggtgttaatg
gtgcaggaaatgaaggtggctttggcagtgaaagaggagaaagatgggtttgtgagtagg
accgagttgggggagcgagtgagggaactcatggaatcggaaacagggaaagatattcgt
cagagggttttcaagatgaaactaagtgctgcggaagcattggttgaaggtggaacttca
cgtgttgcgttggataagttggctaagttatggaaatcgagttgtttcactatttaa

DBGET integrated database retrieval system