KEGG   Phaseolus vulgaris (common bean): PHAVU_006G195600g
Entry
PHAVU_006G195600g CDS       T03093                                 

Name
(RefSeq) hypothetical protein
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PHAVU_006G195600g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     PHAVU_006G195600g
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 18629329
NCBI-ProteinID: XP_007148287
UniProt: V7BUN0
Position
6
AA seq 523 aa
MDLSDDIYLEQALVLKEVKQAFQKLVSEDYMECFYVIDIIQRLGIEHHFQEEIEALLQNQ
CSIFISHISDFANHHKLYELALLFRLLRQRGYHVPADVFEGLKSNKREFRAKHGEDVKSL
IALHEAAQLSIEGEDSLDDAGFLCCQLLHSWLKRHREHHEAIYVANTLQNPLHYGLSRFR
DTTSLALSDYKTKKEWTCIEKLAEINSCIVRMMNQNEIIQVYRWWKDVGMVREEKFCMYE
PLKWYLWPMACFTDPRFSDQRIELTKSISLIYIIDDIFDVYGTLDQLTLFRDAVYRWELG
GAEQLPDFMKMCLSVLYDITNDFAEKVYKRHGLNPIDTLKRSWVRLLNAFMEEAHWLKGG
DLPRSEEYLNNGIVSSGVHVVLLHAFFLFDHSINMESVAVMDNFPQIIYSVAKILRLSDD
LEGAKKKDEKGVDGSYLDCYMNEHQHVSAEDAQNHVSHLIQSEWKRLNEQILTQNELPSS
FTNFCLNAARMVPLMYDYTTNNPCLSIMREELKMVLNVDSGHM
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggatttgtctgatgatatctatctcgaacaagctttggtattgaaggaagttaagcaa
gcattccagaaacttgttagcgaggattacatggagtgtttctatgtcattgacattatc
caaaggcttggcatcgaacaccattttcaagaggaaattgaagcacttcttcagaaccaa
tgttccatatttatcagtcatatcagtgattttgccaatcaccataaactttatgaactg
gcacttttattccgtttacttagacaaagaggatatcatgttcccgcagatgtatttgag
ggcttgaagagtaataaaagagagttcagagctaaacacggtgaagacgtgaagagtctg
attgccctgcatgaggcagcccagctaagtattgaaggagaagatagtcttgatgatgca
ggtttcctctgctgccaacttcttcattcatggctgaaaagacatagagaacatcatgaa
gctatatatgttgctaacactcttcagaatccacttcattatggcttatcaagattcagg
gacacaacaagtttagctctaagtgattacaagaccaagaaagaatggacatgcatagag
aaacttgctgaaataaattcctgcatagttaggatgatgaaccagaatgaaatcattcaa
gtttacagatggtggaaagatgttggaatggtgagggaggagaagttctgtatgtatgaa
cctctgaaatggtacctttggcccatggcatgcttcacagatccaagattttcagaccaa
aggattgaactcaccaaatccatctctctaatctacattattgatgacatcttcgacgtt
tatgggacgttagaccaacttacattatttagagatgctgtctatagatgggaattgggt
ggtgcagagcagcttccagacttcatgaaaatgtgtcttagtgttctttacgatattacc
aatgatttcgccgaaaaggtctacaaaagacatggattaaacccgatagacaccctaaaa
agatcgtgggtgcgattgttgaatgctttcatggaagaggcacattggttgaagggtggt
gatttgccgagatcagaggagtacttgaacaatggaattgtgagctcaggagtgcatgtg
gtgcttctccatgctttcttcctctttgatcactctataaatatggagagtgttgctgtc
atggataactttccacaaattatttattcagtggcaaaaattcttcgtctatctgatgat
cttgaaggagccaagaagaaagatgaaaagggagttgatggatcataccttgactgctac
atgaatgagcaccagcacgtttcagctgaagacgcacagaaccatgtttcccacttgatt
caatctgaatggaaacgtctgaatgaacagattctgacccaaaatgagttgccatcatca
tttacgaatttctgcctgaatgctgcaagaatggtacctttgatgtatgattacaccacc
aataatccatgcctctctataatgagggaagaactaaaaatggtgcttaatgtggactct
ggccatatgtag

DBGET integrated database retrieval system