KEGG   Phaseolus vulgaris (common bean): PHAVU_007G251000g
Entry
PHAVU_007G251000g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K13494  zeatin O-xylosyltransferase [EC:2.4.2.40]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00908  Zeatin biosynthesis
pvu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    PHAVU_007G251000g
Enzymes [BR:pvu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.40  zeatin O-beta-D-xylosyltransferase
     PHAVU_007G251000g
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 18626990
NCBI-ProteinID: XP_007145586
UniProt: P56725 V7BKK4
Position
7
AA seq 454 aa
MALNDETKVVVLLLPFPVQGHLNPFLQLSHLIAAQNIAVHYVGTVTHIRQAKLRYHNATS
NIHFHAFEVPPYVSPPPNPEDDFPSHLIPSFEASAHLREPVGKLLQSLSSQAKRVVLIND
SLMASVAQDAANFSNVERYCFQVFSALNTAGDFWEQMGKPPLADFHFPDIPSLQGCISAQ
FTDFLTAQNEFRKFNNGDIYNTSRVIEGPYVELLERFNGGKEVWALGPFTPLAVEKKDSI
GFSHPCMEWLDKQEPSSVIYVSFGTTTALRDEQIQELATGLEQSKQKFIWVLRDADKGDI
FDGSEAKRYELPEGFEERVEGMGLVVRDWAPQMEILSHSSTGGFMSHCGWNSCLESLTRG
VPMATWAMHSDQPRNAVLVTDVLKVGLIVKDWEQRKSLVSASVIENAVRRLMETKEGDEI
RKRAVKLKDEIHRSMDEGGVSRMEMASFIAHISR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggctttgaatgatgaaaccaaagtggtggtgcttttgctacctttccctgtacaaggt
caccttaacccgtttctgcagctatcccacctaatcgcggcacaaaacatagcagtgcat
tatgttggcactgtcacacacattcgccaagcaaaacttcgataccacaacgctacttca
aacatccatttccatgcctttgaagttccaccctatgtttctcctcctcccaatccagaa
gacgatttcccatctcatctcattccttcctttgaggcctctgcacaccttcgggagcct
gtggggaaactgcttcaatccctttcgtcacaagccaaaagggtcgtactcatcaatgac
tccctcatggcatccgtggcacaagatgctgcaaacttctcaaatgttgaaagatactgt
tttcaagtcttctctgcccttaataccgccggtgatttttgggaacaaatgggaaagccc
cctcttgcagatttccatttcccagatattccttctctccaaggatgcatctcagcccag
ttcacggattttcttactgcacagaatgaattccgcaaattcaacaatggcgatatttac
aacaccagcagggtgattgagggtccttacgttgagttgctggagcgtttcaatggcggc
aaggaggtttgggcactggggccattcacccctttagccgttgagaagaaagattcgata
ggatttagtcacccatgcatggagtggcttgataaacaagagccaagttcagtgatatat
gtatccttcgggaccaccacagctttgagagatgaacaaatccaagagctagcaactggg
ttggaacagagcaagcagaagttcatctgggtgctgagagatgctgataaaggtgatatc
tttgacggaagtgaagcaaaaaggtatgaacttccagagggttttgaggagagagtggaa
ggaatggggctggttgtgagggattgggcaccccaaatggaaattctgagccacagttca
acaggggggttcatgagccattgtggatggaactcgtgcttggagagcttaaccaggggg
gtgccaatggctacatgggccatgcactctgaccagccaagaaatgcagttttggtgaca
gatgttctgaaggttggtttgattgtgaaggattgggaacagagaaaatcgttggtgagt
gcttcagttattgagaatgctgtgagaaggttgatggaaacaaaggaaggtgatgagatc
agaaagagagcagtgaagcttaaagatgagatccataggtccatggatgaaggtggagtt
tctcgcatggagatggcttctttcattgcacacatctctagatag

DBGET integrated database retrieval system