KEGG   Pyrococcus yayanosii: PYCH_00740
Entry
PYCH_00740        CDS       T01543                                 

Name
(GenBank) sugar kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
pya  Pyrococcus yayanosii
Brite
KEGG Orthology (KO) [BR:pya00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PYCH_00740
Enzymes [BR:pya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     PYCH_00740
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: AEH23787
UniProt: F8AFH5
Position
complement(71001..71882)
AA seq 293 aa
MDVVCMGNLNYDITFILDRFPEFHEKVNARSAYFGLGGSAGNTATWLAHLGLRVGFIGAV
GNDDFGRLHIEFFRRIGVDTSRVRVVEVPTGIAVMLIHGEDKRIVKFPGANVFKELDEAY
IAQARHLHLSSNPVELVRRAVAIAKRHGLTVSFDPGEMEVPEDVEAKLDYLIMNEDEFRR
KYGGLGAVKDVKAKNVVVTLNGGGALVRDSAGRVFEVKGLSARVVDSTGAGDAFDAGLVY
GIVKGWSLENATKLGMLLAYLTVQKVGARSAVIPLEDVKRIAERLSLGIFGET
NT seq 882 nt   +upstreamnt  +downstreamnt
atggatgtcgtctgcatgggcaatctcaactacgacatcaccttcatcctcgaccgcttc
cccgagttccacgagaaggtaaatgctagaagtgcttactttgggctaggaggctcggcc
gggaacacggccacgtggctcgcccacctaggattaagggtcggcttcatcggagccgtg
ggaaacgatgactttggcaggcttcacatcgagttctttaggcgcattggcgtggacacc
tccagggtaagggtcgtagaggtgcctaccgggatagccgtgatgctgatacacggtgag
gacaaaaggatagtgaagttccctggtgccaacgtcttcaaagagctcgatgaggcatat
atagcccaggcgaggcaccttcacctgtcctcaaacccagtagagctcgtgagaagggca
gttgccatagccaagagacacggattgaccgtttccttcgatccgggcgagatggaggtg
ccagaagatgtggaagccaagctggactacctgataatgaacgaggacgagttcaggagg
aagtatggaggacttggagccgtgaaagacgtgaaggcgaagaacgtcgtggtgacgctg
aacggcggaggggctctcgttagggactctgccggtagagtattcgaggttaaggggctc
tctgccagggtcgtcgactctactggtgcaggggatgccttcgacgcgggcctcgtttac
ggcatcgttaagggctggtcgcttgagaatgctacaaagctaggaatgctcttggcatac
ctaaccgttcagaaggtgggagctaggagtgctgtaataccactcgaagatgtcaagagg
atcgctgagaggctgagtcttgggatatttggtgaaacttag

DBGET integrated database retrieval system