KEGG   Pyrococcus kukulkanii: TQ32_07520
Entry
TQ32_07520        CDS       T04365                                 

Name
(GenBank) sugar kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
pyc  Pyrococcus kukulkanii
Brite
KEGG Orthology (KO) [BR:pyc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TQ32_07520
Enzymes [BR:pyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     TQ32_07520
SSDB
Motif
Pfam: PfkB LPG_synthase_C
Other DBs
NCBI-ProteinID: AMM54342
UniProt: A0A127BAI7
Position
complement(1404666..1405547)
AA seq 293 aa
MKLDVICMGNLNYDITFLMEKFPEFHEKVNAKSVYTGLGGSAGNTASWLASLGLRVGFIG
AVGDDDFGRLHLEYFKKVGVDVAGIKIVDDATGVAVMMVKGEDKRIVKYPGANRFKEVNE
EYLARARHLHLSSNPIELVRNAVEKAKRLGLTVSFDPGEMEVPPDIEEKLDILMMNEDEF
KRKYGNLERIKDVKARIAIATLNGGGALVRDVNGEVHEVRGLSAKAVDTTGGGDSFNAGF
IYGFLNGWDVVSSAKLGMLLAYLTVQEVGARTAIRPLDEIRKIARELKLGIPL
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaagctcgatgtaatctgcatgggaaaccttaattacgacataacatttctaatggag
aagtttccagagttccacgagaaggttaatgcaaaatcagtgtatacaggccttggaggt
tccgcagggaatacagcaagctggctagcaagcttaggacttagagtgggattcattggg
gctgtgggcgatgacgattttggaaggcttcacttggagtacttcaagaaggtgggtgta
gacgtcgcgggaattaagatcgttgatgacgcgacgggagttgcggtaatgatggtaaag
ggggaggacaagaggatagtcaagtaccctggggcaaacaggttcaaagaagtgaatgag
gagtatttagcgagggcgaggcaccttcacctctcctctaaccccatagagctcgtaagg
aatgctgttgagaaggcgaaaaggctaggattaacggtttcatttgatcctggagaaatg
gaagttcccccggatatcgaagagaagctcgacattttgatgatgaacgaggacgagttc
aagaggaagtatggcaacttagaaaggataaaagatgtgaaggcaaggatagctatagca
actctaaatggtggtggagccctcgtgagggatgtgaatggagaggtgcatgaagtaagg
ggattatcggctaaagccgttgatacaaccggaggtggagactcattcaatgcgggcttc
atatacggcttcctcaacggatgggatgttgtaagctcggccaagcttgggatgctctta
gcgtacttgacagttcaagaagtaggggcaagaacagctatcaggccccttgacgaaata
aggaaaatcgctagagagcttaaacttggaatccccctttag

DBGET integrated database retrieval system