KEGG   Pyrococcus sp. ST04: Py04_1773
Entry
Py04_1773         CDS       T02124                                 

Name
(GenBank) Ribokinase RbsK
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
pys  Pyrococcus sp. ST04
Brite
KEGG Orthology (KO) [BR:pys00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Py04_1773
Enzymes [BR:pys01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     Py04_1773
SSDB
Motif
Pfam: PfkB LPG_synthase_C
Other DBs
NCBI-ProteinID: AFK23341
UniProt: I3RGI1
Position
1723070..1723957
AA seq 295 aa
MAGRLDVICMGNLNYDITFLMEKFPEFHEKVNAKAVYTGLGGSAGNTATWLAHLGLKVGF
IGAVGNDDFGRLHLEFFRKIGVDTKGIKVVEEPTGVAVMMVKGEDKRIVKYSGANKFKEI
NFEYLKLARHLHLSSNPIDLIREAVKAAKSFGLTVSFDPGEMEVPKDIEEKLDILMMNED
EFKRKYGSLENIKEIKSRIAIATLNGGGALVRDEKGKVYEVRGLSAKAVDTTGGGDSFNA
GFLYGFLNGWDTISSAKLGMLLAYLTVQKIGARSAVVPLERVREIAKTLNLDIPL
NT seq 888 nt   +upstreamnt  +downstreamnt
atggccggaagattagacgttatttgcatgggaaatttaaactatgacataacattcctt
atggaaaagttcccagaattccatgagaaagttaatgccaaagctgtttacactggcctc
ggaggttcagctggaaacacggcaacttggctagcccacctagggcttaaagtaggcttt
ataggtgctgttggaaacgatgacttcggcaggcttcacttagaattcttcagaaagata
ggggtagacacaaagggcataaaggtagttgaagaaccaactggagtcgccgtcatgatg
gttaagggagaggacaagagaatagtgaaatattcaggggcaaacaagttcaaggaaata
aactttgagtatctaaagctagctaggcaccttcacttatcctcgaatccaatagaccta
atcagagaagccgtgaaagctgccaaatcttttggattaacggtgtcgttcgatccagga
gagatggaggttcccaaagatattgaggaaaagcttgacatcctcatgatgaacgaggat
gagtttaaaagaaagtatggaagtctggagaacatcaaagagataaagtcgaggatagcc
atagcaaccctcaacggaggaggagcacttgttagggatgagaaaggtaaggtttacgag
gtgagggggctatctgcaaaagccgtcgacactactggtgggggagattcattcaatgca
ggcttcctctacggatttcttaacggctgggacactattagctcggcgaaacttggaatg
ctgctggcttacttaacggttcagaaaatcggggcgagaagtgcggttgtacctttagaa
agggtaagagagattgcaaaaactttaaatctggacatacctctttag

DBGET integrated database retrieval system