KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538168
Entry
108538168         CDS       T04641                                 

Definition
(RefSeq) cytochrome P450 3A8-like
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00140  Steroid hormone biosynthesis
rbb00591  Linoleic acid metabolism
rbb00830  Retinol metabolism
rbb00980  Metabolism of xenobiotics by cytochrome P450
rbb00982  Drug metabolism - cytochrome P450
rbb00983  Drug metabolism - other enzymes
rbb01100  Metabolic pathways
rbb04976  Bile secretion
rbb05204  Chemical carcinogenesis - DNA adducts
rbb05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    108538168
   00591 Linoleic acid metabolism
    108538168
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    108538168
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108538168
   00982 Drug metabolism - cytochrome P450
    108538168
   00983 Drug metabolism - other enzymes
    108538168
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    108538168
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    108538168
   05207 Chemical carcinogenesis - receptor activation
    108538168
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rbb00199]
    108538168
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     108538168
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     108538168
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     108538168
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     108538168
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     108538168
    1.14.14.-  
     108538168
Cytochrome P450 [BR:rbb00199]
 Cytochrome P450, animal type
  CYP3 family
   108538168
SSDB
Motif
Pfam: p450 Coa1 DUF3687
Other DBs
NCBI-GeneID: 108538168
NCBI-ProteinID: XP_017741577
Position
Un
AA seq 504 aa
MDLIPDLAVETWLLLAVTLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGTILSYRKGFWKF
DMECYXKYGKVWGDFYDGRLPVLAITDPNMIKTVLVKECYSVFTNRRPFGPVGFMKNAIS
VAEDEQWKRMRSLLSPTFTSGKLKEMVPIIAKYGDVLVRNLRRETETGKPVTLKDVFGAY
SMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITIFPFLTPILEVLNIX
CFPREVTSFLRKSXKRIKESRLKDTQKRRVDFLQLMIDSQNSKDTESHKALSDLELVAQS
IIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTMLQMEYLDMV
VNETLRLFPIAMRLERVCKKDVEINGIFIPKGVVVMIPSYALHHDPKYWPEPEKFLPERF
SKKNKGNIDPYIYTPFGNGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLRI
GGLLQTEKPIVLKIESRDGTVSGA
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggatctcatcccagacttggctgtggaaacctggcttctcttggctgtcaccctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaactattttgtcctaccgtaagggcttttggaagttt
gatatggaatgttatnaaaagtatggaaaagtgtggggtgacttttatgatggtcgactg
cctgtgctggctatcacagatcccaacatgatcaaaacagtgctagtgaaagaatgttat
tctgtcttcacaaaccggaggccttttggtccagtgggatttatgaaaaatgccatctct
gtagctgaggatgaacaatggaagagaatgcgatcgttgctgtctccaaccttcaccagt
ggaaaactcaaagagatggtccctatcattgccaagtatggagatgtgttggtgagaaat
ctgaggcgtgaaacagagacaggcaagcctgtcaccttgaaagatgtctttggggcctac
agcatggacgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatcca
caagacccctttgtggaaaacaccaagaagcttttaagatttgatttcttagacccattc
tttctctcaataactatcttcccatttctcaccccaattcttgaagtattaaatatcntc
tgttttccaagagaagttacaagttttttaagaaaatctngtaaaaggataaaagaaagt
cgcctcaaagatacacaaaagcgccgagtggatttccttcagctgatgattgactctcag
aattcgaaagacactgagtcccacaaagctctgtctgatctggagctcgtggcccaatca
attatcttcatttttgctggctatgaaaccaccagcagtgttctttccttcattatgtat
gaactggccactcaccctgatgtccaacagaaactgcaggaggaaattgatgcagtttta
cccaataaggcaccacccacctatgatactatgctacagatggagtatctcgacatggtg
gtgaatgaaacgctcagattattcccaattgctatgagacttgagagggtctgcaaaaaa
gatgttgaaatcaatgggatattcatacctaaaggggtggtggtgatgattccaagctat
gctcttcaccatgacccaaagtactggccagagcctgagaagttcctccctgaaaggttc
agcaagaagaacaagggcaacatagatccttacatatacacaccatttggaaatggaccc
agaaactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtc
cttcagaacttctccttcaaaccttgtaaagaaacacagatcccgctgaaattacgcata
ggaggacttcttcaaacagaaaaacccattgttctaaagattgagtcaagggatgggacc
gtaagtggagcctga

DBGET integrated database retrieval system