KEGG   Rhodopseudomonas boonkerdii: E0H22_10990
Entry
E0H22_10990       CDS       T07799                                 
Name
(GenBank) xanthine dehydrogenase family protein molybdopterin-binding subunit
  KO
K03520  aerobic carbon-monoxide dehydrogenase large subunit [EC:1.2.5.3]
Organism
rbk  Rhodopseudomonas boonkerdii
Brite
KEGG Orthology (KO) [BR:rbk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E0H22_10990
Enzymes [BR:rbk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.3  aerobic carbon monoxide dehydrogenase
     E0H22_10990
SSDB
Motif
Pfam: MoCoBD_2 MoCoBD_1 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: UGV28933
Position
complement(2392216..2394492)
AA seq 758 aa
MLVGKSVPRKEDEPLLRGQGKFAADISFPNQLHMRVVRSAYAHGRIVSVDVAPALALPGV
VAAWSFEDVADIPPIDFRLTRLEQLAAYRQTILAKDKVRYVGDPVAVVFAEDPYLAEDGA
DHVDVEIEELPVILHADGEIGEFRDGLPTEAALIDKSYGDVDAAFAMAHATIELSLSIGR
HSGVPMETRGAIGRYIVETDMLEMYGAAKVPHWNRDQLARMFGRTASNTHLYEGHVGGGF
GIRGELYPEDVLVCLAAMRLRRPVKWIEDRREHLISANHSRQQTHHIRAAIDKDGNILAI
DDEFFHDQGGYMRTHAATVPDLTAAMLPGPYRIPAYRARGHIRLTNKTPGGTYRAPGRYE
STFVRERLLDAVAAKVGIDGAEVRRRNLIHTDEMPMKRALETLGTDIVLDSGDYAKLLDK
ALDGIGWMELRVQIDERRKAGEWVGAGLGMFVEKSGLGPFDDVRIAVSIDGHVEVVTGAA
SVGQGVETVIAQICAEKLGVGYDRVSVIHGQTDRIDRGLGAFASRVTVMTGEATRLAALK
LRDLALATAAELMQLPADQLDIVDGEIVRTDGSAGPSMSLAQIAKVLEADDHAPGLVAEA
SFESKHMTYPYGVHIAVVSIAPDTGCVAVERYLVAYDIGKAINPMLVSGQIVGGVAQGLG
GALFEEFNYDDRGEPLAVTLADYLMPTAREVPPVEVLITEDAPSPLNPMGLKGAGEGGAN
AVGAAIAAAIDDALGRPGAITRLPVSPQQIKALINRKM
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgctggttggcaaatccgttccccgcaaggaagacgaaccgctgctgcgcggacaaggc
aagttcgccgccgacatcagcttcccgaaccagctgcatatgcgcgttgtccgctccgct
tatgcgcatggccgcatcgtatcggtcgatgtcgctccagccctcgctctgcccggcgtt
gtcgctgcctggagcttcgaggatgtcgcggatattcctccgatcgattttcgcctgacg
cgcctcgaacagctcgccgcctatcgccagaccattctagccaaggacaaggtacgctat
gtcggcgatcccgtcgccgtcgtgttcgcggaagatccgtatctcgccgaggatggagcc
gaccatgtcgatgtcgagatcgaggagctgcccgtgatcctgcatgccgatggagagatc
ggcgaattccgggacggtctgccgaccgaagcggcgttgatcgacaagagctatggcgac
gtagacgccgccttcgcgatggcgcacgcgaccatcgagctctctctgtccatcgggcgc
cactcgggcgttccgatggaaacccggggagccatcgggcgctacatcgtcgaaacagac
atgctggaaatgtacggcgccgccaaggtgccccactggaaccgcgaccagctagcaaga
atgttcggccgcacggcttccaacacccatctctatgaaggccatgtcggcggcggcttc
ggcattcgtggcgagctctatccggaggatgtgctggtgtgcctcgcagccatgcgcctc
aggcgtccagtaaaatggatcgaggatcgccgcgagcatctgatatcggccaatcattcc
cgacagcagacgcatcacatccgcgcagccatcgacaaggacggcaatattctcgccatc
gacgacgaatttttccacgatcaggggggttatatgcgcacgcatgccgccaccgtcccc
gacctcaccgcagcaatgctgccgggcccctatcgcattcccgcctatcgtgcccgcggg
catatccggctcaccaacaagacgcccggcggcacctatcgtgcgccgggccgctacgaa
agcacttttgtgcgcgagcgcctgctcgatgccgtcgctgccaaggtcgggatcgatggc
gccgaagtccgtcgccgcaacctgatccataccgacgagatgccgatgaaacgcgcgctg
gagacgctcggcaccgatatcgtgctcgactccggcgactatgcgaaactgctcgacaaa
gcgctcgacgggatcggctggatggaactgcgtgtacagatcgacgaacggcgcaaggcc
ggcgaatgggtcggcgccggccttggcatgttcgtggaaaagagcgggctaggtcccttc
gacgatgtcaggatcgccgtcagcatcgatggccatgtggaagtcgtcaccggcgccgcc
tcggtgggccaaggcgtcgagacggtgatcgcacaaatttgcgcggagaagcttggcgtc
ggttatgaccgcgtcagcgtcatccacggccagaccgatcgcatcgatcgcggtctgggc
gccttcgcctcccgcgtcaccgtgatgaccggcgaagccacccgcctcgccgccctgaag
ctgcgcgatctggcgcttgcaaccgcggcggagttgatgcagttgcctgccgatcaactc
gatatcgtcgatggcgagatcgtgcgtaccgatggcagcgccgggccgtcgatgtcgctg
gcccaaattgccaaagtgcttgaagcggatgaccacgctccgggtcttgtcgcggaggct
tcgttcgaatccaagcatatgacctatccttacggggtccatatcgctgtcgtctcgatc
gcgccggataccggctgcgtcgccgtcgagcgctatctggtggcctacgacatcggcaaa
gcgatcaatccgatgcttgtgagcggccagatcgtcggcggggtcgcacaaggcctcggc
ggcgcgctgtttgaagaatttaactatgacgatcgcggcgaaccgctggcggtgacgctt
gcagactatttgatgccaaccgcacgcgaggtgccacccgtggaggtcctcatcaccgag
gatgcaccaagcccgctcaatccgatggggctgaaaggcgccggcgaaggcggcgcaaat
gcggtcggcgcggcaatcgccgcagccatcgacgatgcgcttggccggcctggcgccatc
acgcggctcccggtgtcgccgcagcagatcaaggcgttgatcaatcggaaaatgtag

DBGET integrated database retrieval system