KEGG   Rugosibacter aromaticivorans: PG1C_04270
Entry
PG1C_04270        CDS       T03689                                 

Definition
(GenBank) hypothetical protein
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
rbu  Rugosibacter aromaticivorans
Pathway
rbu00626  Naphthalene degradation
rbu01100  Metabolic pathways
rbu01120  Microbial metabolism in diverse environments
rbu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rbu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PG1C_04270
Enzymes [BR:rbu01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     PG1C_04270
SSDB
Motif
Pfam: DSBA Helicase_Sgs1 iPGM_N
Other DBs
NCBI-ProteinID: AJP47898
UniProt: A0A0C5J832
Position
854905..855504
AA seq 199 aa
MKKHLDFYFDFLSPFAYLAETQIGAIADRFGLELCYKPIDLQAAKLAAGNNGPSNRQVPP
KLRYLTTDMERWAQRYNVPLKFPPTYASERANRGTFYAIDRGQQRDYVHRLYLAVWGQGE
DMSDEAVLRKIAVSLGWSGDEFLAYTQGEDSARRYNEINKEAHARGVFGVPAMFVGNEMW
WGNDRLQFLTEYLESYVSR
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaaaaaacatctcgacttctacttcgatttcctgagcccgttcgcctatttggcagaa
acgcagatcggtgccatcgccgatcgtttcggactcgagctgtgttacaaaccgattgac
ctccaggccgccaagcttgccgccggtaacaacggcccctccaatcgccaggtccccccc
aaattgcgctatctgacgaccgatatggaacgctgggcccagcgttacaacgtaccgctt
aaatttccgcccacttatgcttccgagcgggccaatcgcggcactttctatgcaatcgac
cgtggccagcaacgcgactacgtccatcgcctgtatttggctgtctgggggcagggcgag
gatatgtctgacgaggctgttttacgcaagatcgccgtcagtctcggctggtcgggtgat
gagtttctcgcctatacgcaaggtgaggattccgcccgccgttataacgaaatcaacaaa
gaggcccacgcccgcggtgtcttcggcgtgcctgccatgttcgtcggcaacgagatgtgg
tggggtaacgaccgtctgcaattcctgacagagtatctcgaatcgtacgtgtcccgctga

DBGET integrated database retrieval system