KEGG   Rhodobacter capsulatus: RCAP_rcc01903
Entry
RCAP_rcc01903     CDS       T01213                                 

Name
(GenBank) lysine exporter protein (LYSE/YGGA)
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
rcp  Rhodobacter capsulatus
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rcp02000]
    RCAP_rcc01903
Transporters [BR:rcp02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   RCAP_rcc01903
SSDB
Motif
Pfam: LysE
Other DBs
NCBI-ProteinID: ADE85648
UniProt: D5AUK9
Position
complement(2059669..2060292)
AA seq 207 aa
MEALVLFGKGLFIGLAIAAPIGPMGALCIQRTLARGFWAGVAGGLGTALADLTFATGAAV
GFAVFNDLVERIAVPLGLIGGAFLMVLAWNGWPRGQGGEPSPAKIPEARGLWRTTFVTYG
LTITNPPTILLFAAIFAGLGLAQTGSGLAIVALVAGVFLGSIGWWAFLSGLVAALHHRLP
PAFALWTARVSSLTMAGFGLWAFASIF
NT seq 624 nt   +upstreamnt  +downstreamnt
atggaagcgcttgtgctgttcggaaaggggctgttcatcggcctggccatcgccgcgccg
atcgggccgatgggggcgctgtgcatccagcgcacgctggcgcgcgggttttgggcgggc
gtcgcgggggggctgggcacggcgctggccgatctgacctttgccaccggcgcggcggtg
ggctttgccgtcttcaacgatctggtcgagcgcatcgcggtgccgctgggcctgatcggc
ggggcctttctgatggttctggcctggaacggctggccgcgcgggcaggggggcgagccc
agcccggcgaagatccccgaggcgcgcgggctgtggcgcaccacctttgtcacctatggg
ctgacgatcaccaacccgccgacgatccttttgttcgccgcgatctttgccggtctgggc
ctggcgcagaccggatcggggctggccatcgtggcgctggtcgcgggggtgtttctgggc
tcgatcggctggtgggcgttcctctcggggctcgttgccgcactccatcaccgcctgccg
cccgccttcgcgctctggacggcgcgggtctccagcctgacgatggcgggtttcggcctt
tgggctttcgcctcgatcttctaa

DBGET integrated database retrieval system