GenomeNet

Database: RefSeq
Entry: NC_020205
LinkDB: NC_020205
Original site: NC_020205 
LOCUS       NC_020205              42963 bp    DNA     circular PHG 21-DEC-2020
DEFINITION  Xanthomonas citri phage CP2 DNA, complete genome.
ACCESSION   NC_020205
VERSION     NC_020205.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Xanthomonas citri phage CP2
  ORGANISM  Xanthomonas citri phage CP2
            Viruses; Duplodnaviria; Heunggongvirae; Uroviricota;
            Caudoviricetes; Caudovirales; Podoviridae.
REFERENCE   1
  AUTHORS   Ahmad,A.A., Ogawa,M., Kawasaki,T., Fujie,M. and Yamada,T.
  TITLE     Characterization of Bacteriophages Cp1 and Cp2, the Strain-Typing
            Agents for Xanthomonas axonopodis pv. citri
  JOURNAL   Appl. Environ. Microbiol. 80 (1), 77-85 (2014)
   PUBMED   24123743
  REMARK    DOI:10.1128/AEM.02310-13
REFERENCE   2  (bases 1 to 42963)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2013) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 42963)
  AUTHORS   Ahmad,A.A., Kawasaki,T., Fujie,M. and Yamada,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAY-2012) Contact:Takashi Yamada Graduate School of
            Advanced Sciences of Matter, Hiroshima University; 1-3- Kagamiyama,
            Higashi-Hiroshima, Hiroshima 739-8530, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AB720064.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..42963
                     /organism="Xanthomonas citri phage CP2"
                     /mol_type="genomic DNA"
                     /host="Xanthomonas citri"
                     /db_xref="taxon:1188795"
     gene            join(42178..42963,1..231)
                     /locus_tag="H390_gp01"
                     /db_xref="GeneID:14515732"
     CDS             join(42178..42963,1..231)
                     /locus_tag="H390_gp01"
                     /note="ORF40"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392890.1"
                     /db_xref="GeneID:14515732"
                     /translation="MAGDWLKFEKDTLDKPEVFAIAEALGIDPDAVIGKLMRVWSWFD
                     SHTVDGNAARVTSSLLDRVAGVPGFIAAMALEGWATIETSGVALPHFDRHNGETAKQR
                     ALTAKRVQKHKAKGNDAGNDAGVSGALPREEKRREDVEKQKATGQQAGHDAAPPDELP
                     QDIAKPDAPVPPQDEGEAPPPKRITSTGKKQTAEHFPKFWAAYPVKKGKADALKKWKS
                     KGCDAMADQIIAHVRRMEREDDDWLRGFIPHGSTYINGERWEDEPKKDKAQTAPAPAP
                     DTFGAKAVAERNNTETPLERAMAYIRHQASLGAYGEGEEGQAGMRAAMQAAREKHGGG
                     NGNS"
     gene            454..1398
                     /locus_tag="H390_gp02"
                     /db_xref="GeneID:14515771"
     CDS             454..1398
                     /locus_tag="H390_gp02"
                     /note="ORF1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392891.1"
                     /db_xref="GeneID:14515771"
                     /translation="MAIESKIEWTDATFNPWIGCTKISPACDHCYASVSTPTRRFGVK
                     WGAGEERRRTAPSNWQLPLRWNAQHDQFFAENGRRRRVFCASLADVFDNEVDPSWRAD
                     LFALIEATPNLDWLLLTKRIGNVSKMAPASWVGGPVQHGPDPANIHGGWPANVWLGAT
                     ICNQAEADRDIPKLLATRAAVKFLSMEPLLGEVKLRWDWVSGGRPLGGGPMCNLREPW
                     KTPEPEPALDWVIVGGESGHGARPMNPTWARFLRDQCEAAGVPFLFKQWGEWVSVSEV
                     EGEGPHHQFPTGETLRRIGKHAAGRTLDGALHDGYPHG"
     misc_feature    463..1389
                     /locus_tag="H390_gp02"
                     /note="Phage protein Gp37/Gp68; Region: Gp37_Gp68;
                     pfam07505"
                     /db_xref="CDD:284840"
     gene            1460..1945
                     /locus_tag="H390_gp03"
                     /db_xref="GeneID:14515733"
     CDS             1460..1945
                     /locus_tag="H390_gp03"
                     /note="ORF2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392892.1"
                     /db_xref="GeneID:14515733"
                     /translation="MIDPATGEEVRALVASSNVDRRILQGRKFRPDGRVRCEIKNPRN
                     EGFHRLVHQFGTFLVTHVDGYGHHLTHKGKPDSHAAVKDVQARSGAACERIAYDIDIP
                     GMGLTQVTRSEPRSISFDEMDEDEFAAAFKVMTEYVAEHDYPDLSPEQVADFESLLEQ
                     P"
     misc_feature    <1787..1855
                     /locus_tag="H390_gp03"
                     /note="Protein of unknown function (DUF1367); Region:
                     DUF1367; pfam07105"
                     /db_xref="CDD:284511"
     gene            2262..2717
                     /locus_tag="H390_gp04"
                     /db_xref="GeneID:14515734"
     CDS             2262..2717
                     /locus_tag="H390_gp04"
                     /note="ORF3"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392893.1"
                     /db_xref="GeneID:14515734"
                     /translation="MKIVVYGDPAPQGSKSFKGIHGGHAVLAESSKRVAPWRQDVKLA
                     AEGAIEGCGDPGAWVPMDGPLLLVVVFTLPAPLSLPKRRASYPCKLPDLSKLVRSTED
                     ALTAAGVWKDDARVVECRALKTYPVGTLGAHADALRSPGALIRVFPYLG"
     misc_feature    2280..2636
                     /locus_tag="H390_gp04"
                     /note="Endodeoxyribonuclease RusA; Region: RusA;
                     pfam05866"
                     /db_xref="CDD:283513"
     gene            2936..3952
                     /locus_tag="H390_gp05"
                     /db_xref="GeneID:14515735"
     CDS             2936..3952
                     /locus_tag="H390_gp05"
                     /note="ORF4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392894.1"
                     /db_xref="GeneID:14515735"
                     /translation="MGNSSRSSPASAPETPVNVSVRTPAVMTASVAVCATVSVPSATF
                     ALGPVAPVSPLAPCGPWVPCAPCAPVAPVAPFAPAGPVAPVSPFGPCGPSTPCGPATP
                     GKPRSPCTPIGPCGPATPCGPVSPAGPAGPVSPVGPAGPCGPAGPCGPTSPCGPAGPA
                     SPCAPWNPRGPSGPGGPSAPVAPCGPVSPCGPCGPGTPVSPCCPCSPWPPRGPRMLPT
                     FVQVLPAWFHTYRSPPISHALPGAPVTGSAVVLASSPRMATPAPGGPSCPVNPRGPCG
                     PAGPCGPVAPVGPCVPWSPFLRGSVMSSCISSSCRRSCCMIRRGVIGSRVGAIVFVPW
                     WDDP"
     misc_feature    <3029..3793
                     /locus_tag="H390_gp05"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     gene            4030..4632
                     /locus_tag="H390_gp06"
                     /db_xref="GeneID:14515736"
     CDS             4030..4632
                     /locus_tag="H390_gp06"
                     /note="ORF5"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392895.1"
                     /db_xref="GeneID:14515736"
                     /translation="MSDQAAKLALPIVAEFEGFRPHPYPDPASPLAKATRKEPWGHVP
                     ARSILNRLPAATAALSGAPWTIGYGQTGKYITPDTAPWSDAVARANLEEELQLRVDAV
                     RARAKKDGGVLQDAQVAATASFLFNVGEGRKASGSDPGKDGLFMLKSGRPSTLWRKAM
                     EGCHTCAADQFLAWNKAGGQVMAGLTRRRNAERSLYLRAG"
     misc_feature    4054..4605
                     /locus_tag="H390_gp06"
                     /note="lysozyme_like domain. This contains several members
                     including Soluble Lytic Transglycosylases (SLT), Goose
                     Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes
                     (HEWL), chitinases, bacteriophage lambda lysozymes,
                     endolysins, autolysins, and chitosanases; Region:
                     lysozyme_like; cl00222"
                     /db_xref="CDD:294153"
     misc_feature    4078..4080
                     /locus_tag="H390_gp06"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238249"
     gene            4635..5108
                     /locus_tag="H390_gp07"
                     /db_xref="GeneID:14515737"
     CDS             4635..5108
                     /locus_tag="H390_gp07"
                     /note="ORF6"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392896.1"
                     /db_xref="GeneID:14515737"
                     /translation="MDDFMGPGKVIGIFGAAATAGATAVEVVTKTETVVLNIPLSMLL
                     VAIAGTMIGFFILPSKDAARISPNPGATRRQRIMYVVFSLAIIGAAVIAYAIMSAWII
                     QAGVSIIATVFKGWRVEDGAIMPCTGLVGIGIRLWLPTLLKAVERRADRVIGGSP"
     gene            5105..5662
                     /locus_tag="H390_gp08"
                     /db_xref="GeneID:14515738"
     CDS             5105..5662
                     /locus_tag="H390_gp08"
                     /note="ORF7"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392897.1"
                     /db_xref="GeneID:14515738"
                     /translation="MKWFLWIGGGLAGTAAIVALLYFLGLGGVVRVVRAIGDFLGDLA
                     ESLRAWLRKPGNKVRGLCAVFGFLFLAAGLQSWQRGTVIIQQRADYVALQERTDQEKR
                     TLAQQISDREATIKRFTDLAERQKELLAQAARENEAALASAKLAAARAAESEQKYQEA
                     FQQRPTECKAALEVMAAACPTLKDY"
     gene            5665..5979
                     /locus_tag="H390_gp09"
                     /db_xref="GeneID:14515739"
     CDS             5665..5979
                     /locus_tag="H390_gp09"
                     /note="ORF8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392898.1"
                     /db_xref="GeneID:14515739"
                     /translation="MRALLWLPSILLAACGRQAVKPDIPTTPAGVVEVPVEVYVPIDA
                     DLTARCQWRETAPLEVMPSVARERKKCLQFYEGNLDAIERVQGRPVPKLGQPFPAIKR
                     KK"
     gene            6031..6360
                     /locus_tag="H390_gp10"
                     /db_xref="GeneID:14515740"
     CDS             6031..6360
                     /locus_tag="H390_gp10"
                     /note="ORF9"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392899.1"
                     /db_xref="GeneID:14515740"
                     /translation="MNLSFLATIAFAILVIVGAFLANLVVLVFTNSQWHVSGVVLSIM
                     AAAASYWAQHNFTASAGYTQDVLVNPGLTGLHAAADRAEALGVGFQYLAIALLLAAVA
                     CFWLGLR"
     gene            6712..7149
                     /locus_tag="H390_gp11"
                     /db_xref="GeneID:14515741"
     CDS             6712..7149
                     /locus_tag="H390_gp11"
                     /note="ORF10"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392900.1"
                     /db_xref="GeneID:14515741"
                     /translation="MAGRPTVRHSDLDDRIIGLLQEGKSFRWFDSEEAVGLPSTATIR
                     RWRSDDAEFDAKCARACEASADADYDRMERIEERVLGINVTDKEPQLDAKAANVVLSN
                     MRWRMEKRKGRTYGQKVEVKAQVTLEQLVAESLGGSGTGGGGH"
     gene            7289..8815
                     /locus_tag="H390_gp12"
                     /db_xref="GeneID:14515742"
     CDS             7289..8815
                     /locus_tag="H390_gp12"
                     /note="ORF11"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392901.1"
                     /db_xref="GeneID:14515742"
                     /translation="MTDDTGISTTPVPETAGQRIRRWREHPGQMVRELFGTTPDAWQD
                     QVLAAFPTNPRLAMKACKGPGKTAVLAWLCWNFLLCYLHPKIAAVSITADNLADGLWS
                     EMSKWQKRAPLLQATFTWTKTRIYENGNPETWFMSFRSWAKGGSAEQQADTLAGLHAD
                     NIMFVLDEAGGIPDAVMAAAEAGLANADGINLHAHLVMAGNPTHLSGPLYRATSSERH
                     LWWLIEITSDPDDPMRTPRVSAEWARQQIEKYGRDNPWVLVNVFGKFPPSSMNALLGP
                     DDVSAAMRRQPSDNSWRALARIVGVDVARFGDDASCKARRNGCVMFPLEIGRNLESLQ
                     GAGWVSQEARDFYKDQSNAKADAVFVDDTGGWGAGWIDQLRALNYTVTGVGFAGKADD
                     PRYFNKRTEMYFRFAHAIKHEGLCLPNDPELARELCAHTYYFQGDKMRVIEKDQVKEE
                     LGHSPDRSDAGALTYAYDVAPGDRSQENTGHPRIQSLAAQVAESYGSGDPGTPYNPMG
                     "
     gene            8820..9158
                     /locus_tag="H390_gp13"
                     /db_xref="GeneID:14515743"
     CDS             8820..9158
                     /locus_tag="H390_gp13"
                     /note="ORF12"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392902.1"
                     /db_xref="GeneID:14515743"
                     /translation="MKLVSMKKEGGHGKDCCCCDAAPSGCSEPDYPWGTRISLEEDQI
                     AALGLKSMPAVGAPVGVEAVAMVIGVNEEQRDGKTFRRLELQITDLALAAAGTNKYAR
                     MYADDPSMKD"
     misc_feature    8820..9098
                     /locus_tag="H390_gp13"
                     /note="hypothetical protein; Region: PHA00669"
                     /db_xref="CDD:222809"
     gene            9234..11294
                     /locus_tag="H390_gp14"
                     /db_xref="GeneID:14515744"
     CDS             9234..11294
                     /locus_tag="H390_gp14"
                     /note="ORF13"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392903.1"
                     /db_xref="GeneID:14515744"
                     /translation="MPLSPSATASATGSAPAAAASPPSWPATPIRPPPRPRPSRRRWG
                     CERAEDSPIRWSPSGRRAAVGHPFYPGPAGRARTAPVRYLTGEAMDIDTARAKLDAAA
                     AQPTLQLRQHCDRRRAAMIAARETWMPDWMQVTEYIDPARGQFNGEGTTSTRKKRSRS
                     KIINGTATKCVRVATAGMSSHMTSKARPWFNLTTPDPAMGQVQDVRVWLDNVTTILRD
                     TLAKSNFYKAMPVCYTEDLSYGVAAMMIVENPEEVVRFHPLTIGSYAIGLDDAGKVDS
                     LWRCYTKTARQLVQKYGRLDPETGQRVPDESKLPQRIIQAYKRSPDQEFTVEALYEPN
                     PDARPGMGPLGVQASKFRPFREVVWIAGSGDEKHGVLDIGGHYEQPFVSIRFNPVGDD
                     TYSACPGTDSLGDIKQLQYLEGQKLRLIDLMAEPPVSVPDTMRNIGASLAPRTKNYLP
                     QNQNGAKIEATYTPQPGSLQWVQQEIREVEARIQDSFYYNLFLMLESLGEASGRTATE
                     IAERKEEKATVLGPTLEIVTDEGLDPTVVRVFRLCERAGLIPPPPAILASIPLKIEYT
                     SILAQAMKASGTSGIERTGAFVAQMASVFGPEVMDKFDADQAVDEYSERTGAPASIIR
                     DDDAVLTIRQGRAAQQAQQAALAAAKPMADGAQAIKTLNEAVPQPGSLGEGLAEQLRG
                     GQAA"
     misc_feature    9609..11111
                     /locus_tag="H390_gp14"
                     /note="Bacteriophage head to tail connecting protein;
                     Region: Head-tail_con; pfam12236"
                     /db_xref="CDD:289040"
     gene            11629..12354
                     /locus_tag="H390_gp15"
                     /db_xref="GeneID:14515745"
     CDS             11629..12354
                     /locus_tag="H390_gp15"
                     /note="ORF14"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392904.1"
                     /db_xref="GeneID:14515745"
                     /translation="MNTENTDTANSQQPNPGEGAGAATDAANPNGQSATAPAAAPGQG
                     EGGEKTGGDAGNQGDQGKTGDEGKTGDGQDKTDDQQPALTGAPEAYTDFTLPDGFKLE
                     GERKDVALSLFRDLGLSQAGAQRAIDHFIKTVGEDAAMQQQAMEAAVAQQRDDWGKAA
                     KAELGDKYEAEVAFAKTAVHALQNPKLVEAFDELGWGNHPELIKAFATFGKLMRDSPV
                     DGIGSSGAAKPDAKPWNRMYPDM"
     misc_feature    11719..12267
                     /locus_tag="H390_gp15"
                     /note="putative protease; Region: PHA00666"
                     /db_xref="CDD:222808"
     gene            12398..13411
                     /locus_tag="H390_gp16"
                     /db_xref="GeneID:14515746"
     CDS             12398..13411
                     /locus_tag="H390_gp16"
                     /note="ORF15"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392905.1"
                     /db_xref="GeneID:14515746"
                     /translation="MAILANGQPTLADAAALTTDSGAAVTIAELLEQTNPAFNDIPWE
                     EANSTTGHKVSARQKLPETYLRRINQGIRPSKSGYGSVLESAGLFNALGQVDAKLVEL
                     AVDKARFRFIENKGHIESMGQRFFQSMLYGDPNVVPEDFLGIAPRYASLAAADRTAVQ
                     IIDAGGTGSDLTSIYLVGWGEGSVMGFYPKGTTAGIKHVPLPQNMIDDGTGGKYLGYE
                     DWFDLNAGIAVSDYRNIVRIANIDVSDLQAGDPITGITAGAKLINLMTMALEQLNNPN
                     GLNPVFYVPRVVSTFLRLQIQNKANVWLSTREIAGKKVTDFDGVPVRRMDAISLNETR
                     VVV"
     misc_feature    12398..13405
                     /locus_tag="H390_gp16"
                     /note="major capsid protein; Region: PHA00665"
                     /db_xref="CDD:106974"
     gene            13447..13893
                     /locus_tag="H390_gp17"
                     /db_xref="GeneID:14515747"
     CDS             13447..13893
                     /locus_tag="H390_gp17"
                     /note="ORF16"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392906.1"
                     /db_xref="GeneID:14515747"
                     /translation="MILDQLLYFSDNQAVTADAISNVIDRGSTAPVLANFSPGFAGDL
                     FLVIQTGTAFAGATSLEVKLASDSTADLATSPTTHASTGAIPVANLGANKVVAVLPVP
                     PGDYERYVGLIYDVTGTGTAGTIRAFLTQTPGYWRKMAANNPQARN"
     misc_feature    13447..13827
                     /locus_tag="H390_gp17"
                     /note="hypothetical protein; Region: PHA00664"
                     /db_xref="CDD:106973"
     gene            13947..14537
                     /locus_tag="H390_gp18"
                     /db_xref="GeneID:14515748"
     CDS             13947..14537
                     /locus_tag="H390_gp18"
                     /note="ORF17"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392907.1"
                     /db_xref="GeneID:14515748"
                     /translation="MSNTKALNPRTARTPSGGEQQYVIAHGAPTHYVDGYSLCNAGAI
                     VTLAPGVTPGRWYVEVAPEDAEKAQASETDAQRLAVLAAAKIKAKANSEDVSRKQAAD
                     QAAQAQAAADAQAKAQAEADAIAKLAAADAKAQAAADQATAEKTRADELQAQLDKANA
                     DLAAAQSQLEKVNAAAEADKGKGESKADAKQAGNAK"
     gene            14607..15290
                     /locus_tag="H390_gp19"
                     /db_xref="GeneID:14515749"
     CDS             14607..15290
                     /locus_tag="H390_gp19"
                     /note="ORF18"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392908.1"
                     /db_xref="GeneID:14515749"
                     /translation="MATQTDIFNLALYKLAQSIAIPAVTDESKAADVMNRLWAPMRDL
                     VLTERVWPWAIRSQALALDVEAAQPGWGYRYAYPNDCLTAYAVTDANGIAAAGKLSRF
                     TNGDYIASVWGSGAFDWDTSYGDQATTINTNVRNAFLVYACRVEDTGRYPPQFVNALA
                     CRIAAEAAPPLIGEVGLNNKTQLLQEYTLALTNAGAHAMNESRTDADYVTPALAARDS
                     NVWPGRGPY"
     misc_feature    14607..15284
                     /locus_tag="H390_gp19"
                     /note="hypothetical protein; Region: PHA00662"
                     /db_xref="CDD:222807"
     gene            15292..16683
                     /locus_tag="H390_gp20"
                     /db_xref="GeneID:14515750"
     CDS             15292..16683
                     /locus_tag="H390_gp20"
                     /note="ORF19"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392909.1"
                     /db_xref="GeneID:14515750"
                     /translation="MPKFLQPSLSGGELSPGMRGRVDLARYAISLGMARNFITKPTGG
                     GAKRPGTIFRGRVKFSNKLTRLVPFIYSTSVKYLIEMGDGYFRFWVNGALLTNAQKPI
                     EGISQANPAVVTSTGHGYVAGDQVVITGVRGMTKVNGRTFTVTVATANTFQLAGFDSS
                     ILTAYAGGGSADRIVEVATPYDEAKLRSVRFTQSADVLYIVHGQVPQKELRRLAVNQF
                     ELRDFAFKRGPFRPFNSDEALIMAVSGTTGIVTVSTNVDTFTADMVGSLLYVEEKELR
                     GVKPWASAEKNVPVGALRRSDSKVYRCVSIPASLGSKGTPYWVAGNVRPIHDSGRAFD
                     GPQDIKDDGVNSYAVGVEWEFLHNTFGILQVQSFTDARHVQAVVIERVPDSIVGTAPA
                     PANSWTFSGDGTTKVFSITGALSGSTLDYKVNIDGQPIQPNPYYGGGGGVNGSGGGSV
                     RPGGNSNVQQEAL"
     misc_feature    15616..15798
                     /locus_tag="H390_gp20"
                     /note="Ubiquitin-activating enzyme E1 FCCH domain; Region:
                     E1_FCCH; pfam16190"
                     /db_xref="CDD:292808"
     gene            16683..18395
                     /locus_tag="H390_gp21"
                     /db_xref="GeneID:14515751"
     CDS             16683..18395
                     /locus_tag="H390_gp21"
                     /note="ORF20"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392910.1"
                     /db_xref="GeneID:14515751"
                     /translation="MAQGWTINPTADTITFYEAPPVGTNNILVNELADAGQGGTDVWA
                     VGSWSGRYGYPSEVEFFADRLWFAGTPADPQTIWASCIGDYPNFGRSSPIVDSDTVTF
                     VINARQVNTVKDLVPLDNLLVMTTGGEYKVTGGQDDVVTPSTIGVKNQGNAGSGDVQS
                     KLIGESAIFIQEEGQKIRDLRYQFEKDGFRGNDISVWADHLFAGFEVQWIEYWKAPWQ
                     VVWFTRDDGVRIGCTYMPEQEVVGWHWHDTDGLFLDACALPGKKESECYFLVERLIDG
                     EVVQCIEQQAPTRANSESDMWFVDCGVQYDGRNATATTIQLGSTAGWTEQDELTITAS
                     AALFVGATDVGDGFELWRDVTTVEDGIASTARVKVRLVIDSYVDATHVVARSIGTVPA
                     ALRGVPLASWTFQRDTIDNLWHLEGKRVVLLQDAAVAGPYTVTGGKIGLATPGGVCNI
                     GLPYACEVETLELNSPGGDSMRDQQKLAYKVSILLLASRGVKAGGVTDKLYPVKERRF
                     EPYGQPPYLKTGVFDCDIPAGWGVDAGRVRIVSDDPLPMEILSITTRAVSSNGQAGGA
                     GGKG"
     misc_feature    <16698..18347
                     /locus_tag="H390_gp21"
                     /note="hypothetical protein; Region: PHA00661"
                     /db_xref="CDD:106970"
     gene            18392..18868
                     /locus_tag="H390_gp22"
                     /db_xref="GeneID:14515752"
     CDS             18392..18868
                     /locus_tag="H390_gp22"
                     /note="ORF21"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392911.1"
                     /db_xref="GeneID:14515752"
                     /translation="MIRATIVPATVEHAHAIAENPRAADLAELWACSRSDPLDAMLRG
                     MERTAEPFTAIYNGRPACMFGASPFSIMGGMGSAWMIGSSVLNQHGAQKDLLRLSEPV
                     VEYMQDQFPNLLYNFVDQRNIAAIRWLRWLGFQFSDPIAYGVDGLPFLPFYRRRGV"
     misc_feature    18413..18853
                     /locus_tag="H390_gp22"
                     /note="Protein of unknown function (DUF2833); Region:
                     DUF2833; cl17113"
                     /db_xref="CDD:271795"
     gene            18868..19371
                     /locus_tag="H390_gp23"
                     /db_xref="GeneID:14515753"
     CDS             18868..19371
                     /locus_tag="H390_gp23"
                     /note="ORF22"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392912.1"
                     /db_xref="GeneID:14515753"
                     /translation="MCEPITISTGAAWALGAAAAATAAATYVSYDANKKTGEANAEIA
                     ANNARLAADDAAAAQAMGDRESQQQTWRTRAIMGQQRAAIAANGIDAGIGTPAEILGE
                     TALFGEVDQQAIRLNTARTAWGFNSQVRNIQNQAGIDRFNTRAKGTATVLSGISSIAS
                     SAGGFYG"
     misc_feature    <19051..>19308
                     /locus_tag="H390_gp23"
                     /note="hypothetical protein; Region: PHA00660"
                     /db_xref="CDD:133918"
     gene            19371..21563
                     /locus_tag="H390_gp24"
                     /db_xref="GeneID:14515754"
     CDS             19371..21563
                     /locus_tag="H390_gp24"
                     /note="ORF23"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392913.1"
                     /db_xref="GeneID:14515754"
                     /translation="MATIIPRVTAPQVEVQQGPQVRNTARADDSGAQALAGAIGSFAR
                     PALEYAQREQERNDTTAVMAARKQLSDWEANTFNPGNPDGIGKYKGKNALGADEVLLP
                     DLDKTVGSISAGLTPKQRQQFEGVAMNFRDSVAGRLNGYMDREHSGYITAEQKAAVDN
                     LGADAVSAGVSGDFSRQDRVANELLAMNRARREADGMGEELIKAEERGLVSSVRSQTI
                     EGMATAHPFEAQAYFERYADQMTPEDRAKVDRLLYPVVSDAAAQDDADAILAGAQPQA
                     YRDPGPRGRGPSPAMAKILDEEADAAGVPREYLYALAEQESGFNPNAVNPEVLDDGDN
                     ATGLFQYRATSAQGFDRKDARASARAAAREFAQRAKTGGVEFAVAAHFAGEGGAAAVV
                     QRGRRAENPKTARYVEEVMGRASRWRGDAPVQQVGRTAPPSEADAIERAQAIPDPRRR
                     AAVVGKIRERFQLSDLRRQEEDRAASEGAYTAINQASNPNAPLREILGAQVYAWAERK
                     GHLPTLENLRKNKVAGTFTQDDAVLVESLEREAVLSPQTFAHRDIHALADRISTETLG
                     DLLGKQKQANDPSKRADWASQSQRIESGLRILGLDEAGDNRNAEGEFVAKPPKKKLDE
                     RKVQRAQFAQVYREAERAFIQRNGKDPTPAEADSILRAVVRNVATDIPGKLRRAGAIE
                     GFGAALPAADRAEIISDFRASAGRDPTEAEIVRIGARYRMQSNSAGSN"
     misc_feature    20259..>20390
                     /locus_tag="H390_gp24"
                     /note="lysozyme_like domain. This contains several members
                     including Soluble Lytic Transglycosylases (SLT), Goose
                     Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes
                     (HEWL), chitinases, bacteriophage lambda lysozymes,
                     endolysins, autolysins, and chitosanases; Region:
                     lysozyme_like; cl00222"
                     /db_xref="CDD:294153"
     misc_feature    20316..20318
                     /locus_tag="H390_gp24"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238249"
     gene            21566..29002
                     /locus_tag="H390_gp25"
                     /db_xref="GeneID:14515755"
     CDS             21566..29002
                     /locus_tag="H390_gp25"
                     /note="ORF24"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392914.1"
                     /db_xref="GeneID:14515755"
                     /translation="MGKYSEIIAATQAEDAQARARAAGITAPQVEPDAMGRAMRLADQ
                     RGLPPGVVADNLPEYDQQQQLDALGDAASASPALARWLGDPNHTALSKDDTGVLAGLG
                     RQFNSGLLSAKETLPWLPLPQSALDLDKERKAAAARGPQMMASPDPSWFSELVGKFQS
                     GWEQGKAGAGLLPMPDLGSASSRAIEEQVARGLGYQDAANYDATRTAVYVADQQRRAQ
                     AADVETAATAAGFQEIADAEKTKDTGKIARAVVTNPRAVMAVVAQSLGNTAPQLALSA
                     AMPASRVVAGVTAGTGSFATEQGMTILDVMGDAGVETSDPAAVSAFLRNKPAMEKARQ
                     KALTRGVAVGTFDALTAGFAGRLLANSRRTAASIGSRVVGEGLVQAGGGAAGEATAQL
                     ASEGKITSQSDILLEAAAEVPTFLAEGRGQIAEARRAAMHNADRFDAHQEQRAISDLV
                     NLASQSKTRERSATRFESLIRDMTSEGEDTIYLSADGAQRLFQSANSEGGPDLGALVD
                     ADALREAIATGGEVAIPLAKYATLVTPELHAAVADQVRLQPGGRHDLPAVSSEEIQQA
                     IDQGLAEAQQQDARENGPAGQVYDDVVGQLLSRQDEQLARQNASVVQSVYRNLAERVG
                     TDAWTLYQQFKIRIPGATTDTRARPRGVDIDVDPFLDALRSGKMPTDREIYGDTLVSA
                     LHAAGGLSDSGGELANMDAAKARPGLVNNLAGMSLDDALVWAYQEGFITQAPTNQQEG
                     SYDADAPDINTLLDLLAQDLGGNPVYRPAAMNAERATFRDRAQSLQDELDQRGIDLQQ
                     ADNATARQALGYANRMLEQGQPVEPDAVDYAVRDLVAGPSGRPESAATRALVDQAVAD
                     GDLAKMLQGIAAQEGIDADQAALALRLAEITPDLNVTMVAAPANANAAGIYNNTTNEI
                     WIHQAVPSVVLHEVLHGVTSAMMTSPTLRRSNATVARAVAEFNDLLGAAQAHFAGMET
                     DGADVPAALRATLQDPRGPLSNIKELLTYGMTDKRFQEWLATVPAPAGREESRTAWQW
                     FKDAIATMLGVTGQERTALDALIESTSDLVDFAQANPRAANFAQMSEANRLGAPITDA
                     AAAQGGPAEAFRGVTREQFLGEPRITSNTNAADLRPRALRELDAVDSVPFGDGDLTAK
                     YSDGSAAVFDGDKVVASYNFGDTLVVDRAYRRRGIGEELVYQWRTRNPQASVARERTK
                     ASQALQEKVWDRIQSELAADPRTLNQGGEKPRGAVTFEGVPGARVFNIELLKGMDAST
                     FMHEMGHVYLEVLNDLAARDGAPAQITNDMATLNAWLGREAGTAFTVDQHEQFARGFE
                     AYLREGRAPSSALRRTFAAFKVWLTALYRSVRSLNVELTDDVRNVMDRIVASDAEIED
                     ARAGQYQGALIADGMAVGMTFEQLQAYNEAVNAARADAEATVAAEVLLAERREQQAWY
                     NREKREVRTQVLEEVRNLPVYRAQRLLRNGKLPNGDLAPDELRVKLSKDELLDKFGQS
                     FLRNLVGMYSVEGGVRADDAAAIYGFGSGRELIESLVNAPRLADAVASETDARMKDRH
                     PDPMTDGTLPDRAMIAAHRDRQADVMVREIRALEQHVNGRQVSQAAVIKGVARQIIQD
                     KKLRHLQPATYRSAEAKAGREAFEAAAKQDWGSALAARRRQLLNFELFREAVRARDEA
                     ARTAKYLAKFSETKTRARLGKAGADYLDQVDGLLDRFDFRKISDKAADRRSSLATWIE
                     VQAQKGIDVNLPPKIMDEAFTIPYREMTVADLATLRDAIRSIDHLARLKGKLLLAGEV
                     RDAAEVDAAMAASLAAAHAARPVTTGDRGPKDKLRQAFMQGRVIQATATDMARELDGF
                     KDQGAIWMNTVGVMRDAVNNRLNPALQQAQDDLAKVYVKHYTKAEIRGFSERVPMPEV
                     NGDLWSKSRLLGLALNWGNAGNREAILTQARGRMSSEQVNALLSKLDSRDWAFVEDVW
                     RLIDAQWPAIAEAQKRRTGLVPERVQASAFTVQTSDGKTLQIPGGYYPLKYESDSVKT
                     MKDEADDFYNSIRTGRTAKAATRNGHTIERVGSGGRTVRLDTGVVQQHLRDVLRDVHL
                     GDAVNYVHNVLNGQEFKEAVDSTGMQEYRQALEVWLKDAAAGEIGPRVWHERAMRAAR
                     QNFTASVLTFKVTSALLQLSGVVPTIVTIGQGHTMAGIGQYLGKPRAMTRYVREASPY
                     MDSRLRTHIEAVQTVMDAEAGRFAAGKAASIRFGYWMIGRVQGLVDTVTWLAAEQAGM
                     AKFGNDVARARAYADDVVTRAQGSGEFIDKSPLQRGTLGDNVRQTEWIKATTALQGYM
                     IAKGNLAYEQTRKANLRNPRQAMKWAADMVMLFSVEGLLTAALTAKLPKDDDDDGLWD
                     DLGEWAIKDALSTFFGVIPGGGVLVDQFRGYDSSGVVAGAWRAYAELLEKVTPGEDGE
                     VNLDKGVAKAAVSAAGVTLGLPSTQVNKTIDAIAARADGRDVSPYEYLTGPKKESK"
     misc_feature    <24326..>24841
                     /locus_tag="H390_gp25"
                     /note="virion protein; Provisional; Region: PHA03414"
                     /db_xref="CDD:177642"
     misc_feature    <25253..28963
                     /locus_tag="H390_gp25"
                     /note="crystallin beta/gamma motif-containing protein;
                     Region: PHA00657"
                     /db_xref="CDD:106966"
     gene            29002..30111
                     /locus_tag="H390_gp26"
                     /db_xref="GeneID:14515756"
     CDS             29002..30111
                     /locus_tag="H390_gp26"
                     /note="ORF25"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392915.1"
                     /db_xref="GeneID:14515756"
                     /translation="MTVSANSRRREYQGNGVTQVFNGPMAYARAHVYAFLVKGKTMTL
                     VPNASFDVEKLGYESGTRVTMHTPPAADEMLLLLRTMPYTQETDITNQGAFHAETIEK
                     GFDALEMQIQQLVDGTIQLVFEDGEFVWDAKGSRIIRVGDPTGDQDAVNLRTLYLVIE
                     QIQNGGGSVGVSPKYWEITGDGEDTDFELPGSDVSDLLFYDVVVEGLSKEPYDEYTIV
                     AASDGSDFAVRFPAPLPNGAEGFVILRGYAKPFTGNTPVQTLRIPIIDVDATTYTVDK
                     SSEFALLRTTNVNPCLLTLRANQGDLFDMGDGSYFSVCQRGDGQARIVADTGVTLVLP
                     EGFVPYTRAPGSIISAVCEYAEGDTWVLSGDLAQG"
     misc_feature    29032..29457
                     /locus_tag="H390_gp26"
                     /note="Phage T7 tail fibre protein; Region: Phage_T7_tail;
                     pfam03906"
                     /db_xref="CDD:281845"
     gene            30289..31314
                     /locus_tag="H390_gp27"
                     /db_xref="GeneID:14515757"
     CDS             30289..31314
                     /locus_tag="H390_gp27"
                     /note="ORF26"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392916.1"
                     /db_xref="GeneID:14515757"
                     /translation="MPPGTSVRVDNSTHEVVVAWPEYEPPDPNTTVVPNGSFEAGDVN
                     WSKGAGWLIGQGSGFDAYDGSWSAAYTGRGTSSLEGTRVPVVVGTSITGSIQVQQGGS
                     SKGNVVAGVMLLWYDAAGNLIDYDVGNIVRSGSNGAWHISTVTASAPAGSFYVALGVT
                     ANRKRQNRRLWVDQARWNHSYASGANSDDDYCLVMLVRDAAGREAMWEGCVGERAVFL
                     TTQTYPIDAIEELDSSFVLDGGFLRVPPVLSLTEGADASAVIISGELRTPLLSYVMAP
                     EGVDADAAVMSGELRVVQRSYTMAPEAVDSALAIPSGTLAQVLIATTMTPEGVDSSLT
                     LLSGTLA"
     gene            31311..32243
                     /locus_tag="H390_gp28"
                     /db_xref="GeneID:14515758"
     CDS             31311..32243
                     /locus_tag="H390_gp28"
                     /note="ORF28"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392917.1"
                     /db_xref="GeneID:14515758"
                     /translation="MKTEITPFNVTRTVAGRFKIHALRLDVDGNEIPGSRRLAADWFD
                     NLVVNAGLDRMGQASDYLSACMVGSGSTAPAVGDTQLQSRIASTTSIQSDTNGMVVSP
                     RYGWRRKTFRFAAGVAAGNLSEVGVGWSTVSVFSRALILDGSGNPTTITVLADEVLDV
                     TYELRAYVNESDVTFNVDISGVTYACVLRPANIGGSQGLQIGDQVTINTSNRAGGVRT
                     TESSTLGSVTSMPSGTQSSMGFTNNAYVNGTYYRNHTLTAGLNLSNFSTGIGAVTISN
                     TFSDFQISFTPKIPKDSTKVLTLQARSTWARHVP"
     gene            32233..32808
                     /locus_tag="H390_gp29"
                     /db_xref="GeneID:14515759"
     CDS             32233..32808
                     /locus_tag="H390_gp29"
                     /note="ORF28"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392918.1"
                     /db_xref="GeneID:14515759"
                     /translation="MFRNNALSTVPVPSSFVETVSRRTVPLIDYEMGGVNVADAIQGL
                     NVKLWKLESNGAQMLLSADGVPAIELFNRPNVSQVALAFDQNMRPHVAFVQTGVTWLW
                     WYDSQAGAMVFSSFPGALTPRLTTDEKRPTHLEDSDVILAYVRNNNLYFRMQRDRFLT
                     EYLLKSAVNADLIAIGMNRDYRMQFRLRPNT"
     gene            complement(33018..33584)
                     /locus_tag="H390_gp30"
                     /db_xref="GeneID:14515760"
     CDS             complement(33018..33584)
                     /locus_tag="H390_gp30"
                     /note="ORF29"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392919.1"
                     /db_xref="GeneID:14515760"
                     /translation="MATMNSNSQATDPMALALAELRRATTKFPTWPTDPLHALAVLGE
                     EFGELTKVVLQHTYEPHKSTRGDVREEAIQTAAMALRFVMSLDAYQFARCAQHDQEEL
                     PEREDGPHAALARIRAWCPPQHIQDVEAVRAEFSRLATDHRRLQLADAAIVAVQDMRR
                     TPIVDDDFPEMRDRADLAINRYQLAVRA"
     misc_feature    complement(33345..33533)
                     /locus_tag="H390_gp30"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) MazG-like domain superfamily; Region: NTP-PPase;
                     cl16941"
                     /db_xref="CDD:302582"
     misc_feature    complement(order(33363..33365,33372..33374,33441..33443,
                     33450..33452))
                     /locus_tag="H390_gp30"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212133"
     gene            complement(33829..34191)
                     /locus_tag="H390_gp31"
                     /db_xref="GeneID:14515761"
     CDS             complement(33829..34191)
                     /locus_tag="H390_gp31"
                     /note="ORF30"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392920.1"
                     /db_xref="GeneID:14515761"
                     /translation="MGSNETSNAFGNAPRVTTEQVEAAIVGETYTVLPNGRTTVCQLT
                     LDNGFTVEGMSACVSIENFNAELGNKYSRQRAVDQVWQLLGFRLQDTLPRAAGGLPEG
                     GQRAADAPPIEQFARSAD"
     misc_feature    complement(33916..34146)
                     /locus_tag="H390_gp31"
                     /note="Phage protein (N4 Gp49/phage Sf6 gene 66) family;
                     Region: Phage_gp49_66; pfam13876"
                     /db_xref="CDD:290587"
     gene            complement(34225..34710)
                     /locus_tag="H390_gp32"
                     /db_xref="GeneID:14515762"
     CDS             complement(34225..34710)
                     /locus_tag="H390_gp32"
                     /note="ORF31"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392921.1"
                     /db_xref="GeneID:14515762"
                     /translation="MNAARMQSIIHGLTGIARKVYDTVPIQEGWTLAQVSAELGRNGL
                     VYEHAKVHGCLRSLKEQGLIRECDGQFQRIEQRPRLVATRTPTNTPQEHDMPAPTSSD
                     PMANLAEIAATLREQARQLLAKADALDAAAIDVAETIERSGEDSAKLRQLQALLKDIS
                     K"
     gene            complement(34723..35160)
                     /locus_tag="H390_gp33"
                     /db_xref="GeneID:14515763"
     CDS             complement(34723..35160)
                     /locus_tag="H390_gp33"
                     /note="ORF32"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392922.1"
                     /db_xref="GeneID:14515763"
                     /translation="MNIENDVRLIGNLGDDPKVTYTQGGMAITRISIATTSKRKDREG
                     NQVEETQWHRVVFFGKLAEIAGEYLRKGSKIAVAGMIRYGKYEKEGVTHYTTDIACDQ
                     MKMLDARPADGERAQRPAPQRQQQAPQRQAPPMDDFADDDIPF"
     misc_feature    complement(34726..35148)
                     /locus_tag="H390_gp33"
                     /note="Replication protein A, class 2b aminoacyl-tRNA
                     synthetases, and related proteins with
                     oligonucleotide/oligosaccharide (OB) fold; Region:
                     RPA_2b-aaRSs_OBF_like; cl09930"
                     /db_xref="CDD:299125"
     misc_feature    complement(34726..35148)
                     /locus_tag="H390_gp33"
                     /note="Single-stranded DNA-binding protein [Replication,
                     recombination and repair]; Region: Ssb; COG0629"
                     /db_xref="CDD:223702"
     misc_feature    complement(order(34873..34875,34882..34884,34912..34914,
                     34939..34941,35002..35004,35008..35010,35050..35058,
                     35131..35142))
                     /locus_tag="H390_gp33"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(34864..34866,34870..34872,34906..34911,
                     34915..34917,34921..34923,34945..34950,34987..34989,
                     34993..34995,34999..35001,35005..35007,35011..35016,
                     35047..35052,35071..35073,35101..35103,35119..35127))
                     /locus_tag="H390_gp33"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(34849..34851,34927..34929,34933..34935,
                     34939..34941))
                     /locus_tag="H390_gp33"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            complement(35157..35534)
                     /locus_tag="H390_gp34"
                     /db_xref="GeneID:14515764"
     CDS             complement(35157..35534)
                     /locus_tag="H390_gp34"
                     /note="ORF33"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392923.1"
                     /db_xref="GeneID:14515764"
                     /translation="MGARTPSPPYPRMMKRVRVAESGCWLYTGSKDGGGYGTVSIRRG
                     AAPGKAHRISYEHHVGAIPVGAMVCHRCDTPACVNPDHLFIGTQGDNMQDCASKGRIS
                     PRSILNLQPGAPGHHGAAPRKQA"
     misc_feature    complement(35256..35390)
                     /locus_tag="H390_gp34"
                     /note="HNH endonuclease; Region: HNH_3; pfam13392"
                     /db_xref="CDD:290128"
     gene            complement(35534..36157)
                     /locus_tag="H390_gp35"
                     /db_xref="GeneID:14515765"
     CDS             complement(35534..36157)
                     /locus_tag="H390_gp35"
                     /note="ORF34"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392924.1"
                     /db_xref="GeneID:14515765"
                     /translation="MLDELQIFEDLEQGTPEWHAARCGVVTASVFHTVLAKGRNGAPS
                     ETRKKLLYQLAAETITGEYVPTWDGNKHTERGHVMEPQVRDLYMATSDHECRQVGFMR
                     RGRIGCSPDTLVGDDGLLEIKTKLPHLQIEAVLAGKLPSEHVAQVQGQLLVSGRQWCD
                     FRSYWPGLPELRVRVHRDLAYLSTLNQELQQFIRELDALVAQIKAMA"
     misc_feature    complement(35687..36109)
                     /locus_tag="H390_gp35"
                     /note="YqaJ-like viral recombinase domain; Region: YqaJ;
                     pfam09588"
                     /db_xref="CDD:286647"
     gene            complement(36385..37227)
                     /locus_tag="H390_gp36"
                     /db_xref="GeneID:14515766"
     CDS             complement(36385..37227)
                     /locus_tag="H390_gp36"
                     /note="ORF35"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392925.1"
                     /db_xref="GeneID:14515766"
                     /translation="MNTTTTPIEGDVLDSMPTTQSAPNTALAHSTNPFQQMAVIAMEK
                     GAMDQFEKLLDLQLKWDAEQARKAFVAAMASFKAEPIDIRKTKAVGYSTSDGGFVGYK
                     HATLADVVDGVVAALGKHGLSHRWDVKQEAGQITVACIVAHRDGHSESVEMFAAPDNS
                     GKKNAIQQVASTVAYLQRYTLMSATGVAAKDMDDDGVVGGAPQVEFINDEQVAILRDL
                     IDAYVVNEGKFMDWVRGACRNQQIQALEEVPADCYNRIHDQLGRIRKQKVADAKQQEG
                     AANG"
     misc_feature    complement(36595..36951)
                     /locus_tag="H390_gp36"
                     /note="ERF superfamily; Region: ERF; pfam04404"
                     /db_xref="CDD:282284"
     gene            complement(37496..39031)
                     /locus_tag="H390_gp37"
                     /db_xref="GeneID:14515767"
     CDS             complement(37496..39031)
                     /locus_tag="H390_gp37"
                     /note="ORF36"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392926.1"
                     /db_xref="GeneID:14515767"
                     /translation="MRPTRIRLFERRRRGATSPGRGARAAAGWIPHHHHTKDRTMSHE
                     IDPAAEQDQDATTAAKAGALALRHAAMQELESVEAGLADLAAKYKGVVFDVTTTKGMD
                     EAKAARAAIREPRYKAENIRKEKTSQLSKLGKEINERAGTIKDAILAIEDPIDKQIKA
                     EEDRKEAEREAKRQAEADRIAGMNARLDNIRNMPLQAVGASADELQQAIDRVATDELE
                     GFDEVYLPTAQQTRDTALDALRKMLAERQALDEQAAQLERQRQEQAARDAEAAEQRRI
                     ADEAAQAERDRLAAEAQAKADAEAKARREQQEKEDADRAARQAEEDRQRAAQAEADRV
                     ERERVQAEQAARQAELDRQAAEQRQRDEAAAQAQREAQEKANQERRDREAAEQAAAAQ
                     ARAQAEAEASRRAALLYVVAMPDGSRWAVPLMVIATDRAKHYAQEFDGDLERSLAEDT
                     LPLFDADPYQAHDWAANNMNWSDVKGEARIYEPAKPLGDDDFAEGWVNGEYQVVNTQA
                     VNA"
     misc_feature    complement(<37892..>38902)
                     /locus_tag="H390_gp37"
                     /note="MAEBL; Provisional; Region: PTZ00121"
                     /db_xref="CDD:173412"
     gene            complement(39072..39896)
                     /locus_tag="H390_gp38"
                     /db_xref="GeneID:14515768"
     CDS             complement(39072..39896)
                     /locus_tag="H390_gp38"
                     /note="ORF37"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392927.1"
                     /db_xref="GeneID:14515768"
                     /translation="MDKSAIEAIQDSSAAAAKATQEQIPASIAHLVAVPNGVTLQNVE
                     ASLAGRTRFRGKLTTSSIPDFVSYVKARVGGHGFIDTDKLGATVFFNLGDAEKPGHAD
                     HTARLTLQATPAYLAMLSAGGKAFSQRDALDFIEDWSHLIGAHQVSDDGAFTPIPLAR
                     AIAAIRRVKIKAESTTEQTEGNFQQSRSVLESVSASSDEGLPDVLSFKTEPYLGLPER
                     TFHLRVSVSTTGLEPSLRFRVIALEQEQDEIAKQFKALLLGEVGDAASMTIGSFTP"
     misc_feature    complement(39081..39893)
                     /locus_tag="H390_gp38"
                     /note="Uncharacterized conserved protein (DUF2303);
                     Region: DUF2303; cl02338"
                     /db_xref="CDD:295263"
     gene            complement(39951..40325)
                     /locus_tag="H390_gp39"
                     /db_xref="GeneID:14515769"
     CDS             complement(39951..40325)
                     /locus_tag="H390_gp39"
                     /note="ORF38"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392928.1"
                     /db_xref="GeneID:14515769"
                     /translation="MNPNHTPIETLMAELDGGTLGPRLAAALAESALGVAACNTKTKK
                     GKVTLEFTITPVGGDQTQVQIDHTVKFSSPTQRGKKQEDISTSSVMYVSNRGAITVLP
                     NTNKDLFKPEDGVASGNVAAIR"
     gene            41829..42176
                     /locus_tag="H390_gp40"
                     /db_xref="GeneID:14515770"
     CDS             41829..42176
                     /locus_tag="H390_gp40"
                     /note="ORF39"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_007392929.1"
                     /db_xref="GeneID:14515770"
                     /translation="MMTDSNERSAAQAARDAGIQQAAEHADDVNPNWGDRAFEVLRMF
                     AAAKRASGTSFTSEDVRNSILGAHLPQPPHLRAWGSVFQRAAKQGMIVKTGVTESRAV
                     HCHCAFVATWKAV"
ORIGIN      
        1 ccgaagaagg acaaggcgca gaccgcaccg gcaccggcac ccgatacgtt cggcgcgaag
       61 gcagtggccg agcgcaacaa cacggaaacg ccgctggaac gcgccatggc ctacatccgg
      121 catcaggcca gtttgggcgc ctatggcgag ggcgaagagg gacaggcggg catgcgtgct
      181 gcgatgcagg ccgcgcgtga gaagcacggg ggcggcaatg gcaattcctg agtcagcgcc
      241 gcgagcgacc gcggcgagca tggccgagcg catcagcgtg gatctgtgcg aagcgctgct
      301 gggcctgcgc acccggctgc tggtggtgga catcatgcgc cggtaccggt gcaagcgcgg
      361 caccgcgatg cacgccgtgg cactggcgcg tgttcgtgtg gggatagagc gccgcatcag
      421 cggcatttaa tcaacgggag aaaggggaat accatggcaa tcgaaagcaa gatcgaatgg
      481 accgacgcca cgttcaatcc gtggatcggc tgcaccaaaa tcagcccggc gtgtgaccac
      541 tgctacgcca gcgtgtccac gcccacgcgc cggttcggcg tgaagtgggg cgcaggcgag
      601 gaacgccgcc gcaccgcgcc ttcgaactgg cagctgccgc tgcggtggaa cgcgcagcac
      661 gatcagttct tcgcggagaa cggccggcgt cgccgcgtgt tctgcgcgag cctggccgac
      721 gtgttcgaca acgaagtgga cccgtcgtgg cgcgccgacc tgttcgcgtt gatcgaagcc
      781 acgccgaacc tggactggct gctgctgacc aagcgcatcg gcaacgtgtc gaagatggcg
      841 cccgcctcct gggttggcgg cccggtccag cacggcccgg acccggcgaa catccatggc
      901 gggtggccgg ctaacgtgtg gctgggcgcg acgatctgca accaggccga agccgaccgc
      961 gacatcccga agctgctggc cacgcgcgcg gcggtcaagt tcctgtcgat ggaaccgctg
     1021 ctgggtgaag tgaagctgcg ctgggattgg gtgagcggtg gccggcccct gggcggcggg
     1081 ccgatgtgca atctgcgcga gccgtggaaa acgccggagc cggaaccggc cctggattgg
     1141 gtgatcgtag gtggcgaaag cggccatggc gccaggccca tgaaccctac gtgggcgcga
     1201 ttcctgcgcg atcagtgcga agccgctggc gtgcctttcc tgttcaagca gtggggcgaa
     1261 tgggtatccg tttcggaagt cgaaggcgaa ggcccgcacc accagttccc gactggggag
     1321 acgttgcgcc ggatcggaaa gcacgccgca ggccggacgc tggatggcgc gctgcacgac
     1381 ggttatcccc atggctgacc atccgcattc gaccacgcgc aagatcgcgc ggcgctacgt
     1441 ctacatgaag tggcgcacga tgatcgatcc ggcgaccggc gaggaagtgc gcgcgctggt
     1501 ggccagcagc aacgtggatc ggcggatcct gcaggggcgg aagttccgcc ccgatgggcg
     1561 cgtgcgctgc gaaatcaaga acccgcgcaa tgaggggttc caccgcctgg tgcatcagtt
     1621 cggcacgttc ctggtcacgc acgtggacgg ctacggccac cacctgacgc acaagggcaa
     1681 gccggattcg cacgccgcgg tgaaggacgt gcaggcgcgc agcggcgcag cctgcgagcg
     1741 aatcgcctac gacatcgaca tccctgggat gggcctgacc caggtaacgc gcagcgagcc
     1801 gcgcagcatt tccttcgatg aaatggacga agacgaattc gccgccgcct tcaaggtgat
     1861 gaccgaatat gtcgccgaac acgactaccc cgacctgtca cccgaacagg tcgccgactt
     1921 cgaatcccta ctggaacaac catgatccgc gacctgtatg caaagctccc caaggaagcg
     1981 ccggaatacc tggcgttcgt ccgttcgctg ccgtccgcgg ccagcggcat gatcggctgc
     2041 gtggcgcacc accgcatcgg tggccggctg tcgcagcaca aggtcagcga cttcgacacc
     2101 atgccgctga cggatgagga acaccgcgaa ctgcatgccg gcatggccgc gttcgtggag
     2161 aagtacggca agaccgaagc ggacatggtg aaggccacgc tgctggaagc catccgcctg
     2221 ggcgtgttga agttcgacgc gcgcgctgcc agggaactgg catgaagatc gtggtgtacg
     2281 gcgatccggc gccgcagggc agtaagtcct tcaagggtat tcacggcggg cacgcggtgc
     2341 tggccgaatc atcgaagcgc gtggcgccgt ggcgtcagga cgtgaagctg gcggcggaag
     2401 gagcaatcga aggctgcggc gatcctggtg cgtgggtgcc gatggatggc ccgctgctgc
     2461 tggtggtggt tttcacactg ccggcgccgc tgtcgctgcc gaagcgccgc gcatcgtacc
     2521 cgtgcaagct gcccgatctg tcgaagctgg tgcgcagcac ggaagacgcg ctgaccgcgg
     2581 ccggcgtgtg gaaggatgac gcgcgcgtgg ttgagtgccg ggcgttgaaa acctaccccg
     2641 tggggacgct gggcgcgcac gctgacgcac tgcgcagccc tggcgcgttg atccgggtgt
     2701 ttccctacct gggatagcgt ggcatgatgc gggcgcggcc atcccctgcc gcctccccgc
     2761 cccggcctgc atccccagca ggccggggtt tctttttcag cgcagcgcca ccaggcggca
     2821 ggggatcgaa taggtggcgc cgatggccag cagcggcgcg gtcagcgtga cttccaccgt
     2881 tcccgccgtg gggcatcgca ggttgtggat ggcgtagccg gccggcagcg ccgtcgtggg
     2941 gaacagcagc agatcgtcgc cggccagcgc acccgaaacc ccggtgaacg tcagcgtgcg
     3001 cacgcccgcc gtgatgaccg ccagcgtggc cgtctgcgcc acggtcagcg ttcccagcgc
     3061 caccttcgcg ctgggtccgg tcgcgcctgt gtcgcccttg gcgccctgcg gcccctgggt
     3121 gccctgcgca ccctgcgcgc ccgttgcccc tgtggcgccc ttcgcaccag ccggtcccgt
     3181 tgctccggtg tcgcctttcg gaccctgcgg gccttctacg ccctgcgggc cggccacgcc
     3241 ggggaagccg cgttcgccct gcacgcccat cggaccctgc ggccctgcca cgccttgcgg
     3301 cccagtttcc ccggccggtc cagcggggcc ggtgtcgcca gtcggcccgg ccgggccttg
     3361 cggtccagcc ggcccctgcg gtccgacctc gccctgcggc ccagccgggc cggcatcgcc
     3421 ctgcgcgccc tggaacccgc gcggaccctc cggtccaggc gggccatctg cgccggttgc
     3481 accctgcggc cccgtctcac cctgcggacc ctgtgggcct ggcacgcccg tttcgccctg
     3541 ctgtccctgc tcgccctggc cgcctcgcgg gccgcggatg ttgcccacgt tcgtccaggt
     3601 gcttccggcc tggttccaca cgtacaggtc gccgccgatc agccatgcgt tgccgggcgc
     3661 gcccgtcacc ggcagcgcgg tggtgctggc cagttcgccc aggatggcca cgccagcacc
     3721 gggcggccct tcttgcccgg tcaatccgcg cggcccctgc gggccagctg gcccctgcgg
     3781 gccggtggcg ccggtcgggc cttgcgttcc ctggtcaccc ttcctgcgcg gcagcgtcat
     3841 gtccagctgc atttcgtcgt cctgccggcg cagctgctgc atgatccggc ggggcgtcat
     3901 cgggtcacgg gtcggtgcca tcgtcttcgt tccatggtgg gatgatccat gataggcgcg
     3961 cgcgattgac caggcacgcg catggcgcca ccatggcgca accgtccagc gtcaattcca
     4021 ggggaagcca tgtccgacca agccgcgaag ctcgcgctgc ccatcgtcgc cgagttcgaa
     4081 gggttccgcc ctcatccgta cccggatccg gccagcccgc tggccaaagc cacgcggaag
     4141 gagccgtggg gccacgtccc cgcgcgctcg atcttgaacc gcctgccggc cgccaccgcg
     4201 gcgctgtccg gcgcaccgtg gaccatcggc tacgggcaga cgggcaagta catcacgccc
     4261 gacaccgcgc cctggtccga tgcagtcgcc cgcgcgaacc tggaagagga actgcagctg
     4321 cgcgtggatg cggtgcgcgc gcgcgccaag aaggacggcg gggtgctgca ggacgcgcag
     4381 gtggcggcca ccgccagctt cctgttcaac gtcggcgagg ggcgcaaggc gtccggcagc
     4441 gatccgggca aggatgggct gttcatgctc aaatccggcc ggccctcgac tctgtggcgc
     4501 aaggccatgg aagggtgcca cacctgcgcg gcggaccagt tcctggcctg gaacaaggcc
     4561 ggcggccagg taatggccgg cctcacgcgg cgccgcaacg cggagcgtag cctgtacctt
     4621 cgggcgggct gacggtggac gacttcatgg ggccgggcaa ggtcatcggg atattcggcg
     4681 cggcggcgac tgccggcgcc actgcggtgg aagtggtcac caagaccgaa accgtggtgc
     4741 tgaacatccc gctgtcgatg ctgctggtgg ccatcgccgg caccatgatc ggctttttca
     4801 tcctgccgtc gaaggacgcc gcgcgcatca gcccgaaccc tggcgccacg cgccggcagc
     4861 ggatcatgta cgtggtgttc tcgctggcca tcatcggcgc cgcggtcatc gcctacgcca
     4921 tcatgtcggc ttggatcatc caggcgggcg tgtccattat cgccaccgtc ttcaagggat
     4981 ggcgcgtcga agacggggca atcatgccct gcactggcct ggtcggaatc ggcatccgtc
     5041 tgtggcttcc taccctcctg aaagctgttg agcggcgcgc cgaccgcgtt atcgggggtt
     5101 ccccatgaag tggtttctgt ggatcggcgg cgggctggcc ggcacggcgg caatcgtcgc
     5161 cctgctgtac ttcctcggcc tcggtggtgt cgtgcgggtc gtcagggcca taggcgactt
     5221 cctgggtgac ctggccgagt cgttgcgggc ctggctgcga aagcctggca acaaggtccg
     5281 cgggctgtgc gcggtgttcg gcttcctgtt cctggccgcc ggcctgcagt cgtggcaacg
     5341 cggcacggtc atcatccagc agcgcgccga ctacgtggcc ctgcaggaac gcaccgacca
     5401 ggagaagcgg acgctggccc agcagatctc ggaccgggaa gcgaccatca agcgcttcac
     5461 cgacctggcc gagcgccaga aggaactgct ggcccaggcg gcgcgcgaga acgaagcggc
     5521 cctggcctct gcgaagctgg ccgcggcacg cgcggctgag tcggaacaga agtaccagga
     5581 ggccttccag cagcggccca ccgaatgcaa ggcggcgctg gaagtgatgg ctgcagcctg
     5641 cccgaccttg aaggattact gaccatgcgc gctttgcttt ggctcccctc catcctgctg
     5701 gccgcctgcg ggcgccaggc cgtgaagccg gacattccca ccaccccggc cggcgtggtc
     5761 gaagtgccgg tggaagtgta cgtgcccatc gacgccgacc tgaccgcgcg ctgccagtgg
     5821 cgggagacgg cgccgctgga agtcatgccc agcgtggccc gagagcgcaa gaagtgcctg
     5881 cagttctacg aaggcaacct ggacgccatc gaacgggtgc agggccggcc cgtcccgaag
     5941 ctgggccagc cgttccccgc catcaaacgg aagaagtaac gcacgaagcg ttacctgcgc
     6001 cgttaccacg tcgttaccgg agcgtatccc atgaacctgt cgtttctcgc caccatcgcc
     6061 ttcgccatcc tggtgatcgt cggcgccttc ctggccaacc tggtcgtgct ggtgttcacg
     6121 aacagccagt ggcacgtgtc gggcgtcgtg ctgtcgatca tggccgccgc cgccagctac
     6181 tgggcgcagc acaacttcac cgcctcggcc ggctacacgc aggacgtgct ggtgaaccct
     6241 ggcctgaccg ggctgcacgc ggccgctgac cgggccgaag cgctgggtgt cggcttccag
     6301 tacctggcca tcgccctgct gctggctgcg gtcgcctgct tctggctggg gctgcggtga
     6361 tgcgcgggct gcgctgcgcc tgctgggtgg cggcatccct ggccaccgtg ctggccggga
     6421 ccgtgtgcgc cagctggctg ggtggatccg gcggtatggg cgtggccata gtggcgaccg
     6481 tgctggcgct gctcatggcc cagcgtgctg aggcgacttg gtgatggaag gggacaagaa
     6541 cagcaaggcg tccccgccga tctactggac cgccccggcc gcgccggccg gctgggtgag
     6601 cctgggcgat caggtggagg tgtacaccgt ccaggagttc gcaacccacg aagaggccgt
     6661 ggccgcgctg cggctgttgg ccatgcctgc cgccagccag agggtgcagt gatggctggc
     6721 cggcctacgg tgcggcactc ggatctggac gaccggatca ttggcctgtt gcaggagggc
     6781 aagtcattcc gctggttcga ttccgaagag gctgtggggc ttccgtccac ggccacgatc
     6841 cggcgctggc ggtccgacga tgccgaattc gatgccaagt gcgcgcgcgc gtgcgaggcc
     6901 tcggcagacg ccgactacga ccgcatggag cggatcgagg aacgcgtgct gggcatcaac
     6961 gtcaccgaca aggaacccca gctggacgcg aaggccgcga acgtggtgct gtcgaacatg
     7021 aggtggcgga tggagaagcg gaagggccgg acctacggcc agaaggtcga ggtgaaggcg
     7081 caggtgacgc tggaacagct ggtcgcggaa agcctgggcg ggtccggtac cggcgggggt
     7141 ggccattgat ccgggccgcc gccatccgcg tgctgttcct gctgggcggc ctggtgtacc
     7201 cgtgtcgctg gtggggctgc agccgcgact ggccggaaat ggaaacctgc gggcgctgtg
     7261 gccggcacat gccgctggac ggtgagccgt gaccgacgac accggcatca gcaccacccc
     7321 ggtcccggag acggccggcc agcgcatccg ccgctggcgc gagcatccgg ggcagatggt
     7381 ccgggaactg ttcggcacaa cccccgacgc ctggcaggac caggtgctgg ccgccttccc
     7441 gacgaacccg cgcctggcca tgaaggcgtg caaggggccg ggcaagaccg ccgtgctggc
     7501 ctggctgtgc tggaacttcc tgctgtgcta cctacacccg aagatcgccg cggtatcgat
     7561 caccgccgac aacctggcgg acggcctgtg gtcggaaatg tcgaagtggc agaagcgcgc
     7621 gcccctgctg caggcgacct tcacctggac gaagacccgg atctacgaga acggtaaccc
     7681 cgaaacctgg ttcatgtcgt tccggtcttg ggccaagggc ggcagcgccg agcagcaggc
     7741 cgacaccttg gcgggcctgc acgccgacaa catcatgttc gtcctggatg aggcgggcgg
     7801 catccccgac gccgtgatgg ccgcggccga agccggcctg gccaacgcgg acggcatcaa
     7861 cctgcacgcg cacctggtga tggcgggaaa ccccacgcac ctgtccggcc ccctgtaccg
     7921 ggcgaccagc agcgaacggc atctgtggtg gttgatcgaa atcacgtccg acccggacga
     7981 cccgatgcgc acgccgcgcg tgtccgccga gtgggcgcgc cagcagatcg agaagtacgg
     8041 ccgcgacaac ccgtgggtgc tggtcaacgt gttcggcaag ttcccgccgt ccagcatgaa
     8101 cgccctgctg gggccggatg acgtgtccgc cgccatgcgc cgccagccca gcgacaacag
     8161 ttggcgcgcc ctggcccgca tcgtgggcgt ggacgtggcc cggttcggcg atgacgccag
     8221 ctgcaaggcc cgccgcaacg gctgcgtgat gttccccctg gaaatcggcc gcaacctgga
     8281 aagcctgcag ggtgccggct gggtgtcgca ggaagcccgc gacttctaca aggaccagtc
     8341 gaacgccaag gccgacgcgg tgttcgtgga cgacacgggc ggctggggtg ccggctggat
     8401 cgaccagctg cgcgccctga actacaccgt gactggggtg gggttcgccg gcaaggccga
     8461 cgatccgcgc tacttcaaca agcgcaccga aatgtatttc cggttcgccc atgccatcaa
     8521 gcacgaaggg ctttgcctgc ccaacgaccc cgaactggcc cgcgagttgt gcgcccacac
     8581 ctactacttc cagggcgaca aaatgcgcgt catcgagaag gaccaggtga aggaggaact
     8641 gggccactcg ccggaccgtt cagatgcggg cgcgttgacg tatgcttatg acgtggcgcc
     8701 gggggatcgg agccaggaga acaccggcca ccctcgcatc cagtcgctgg ctgcgcaggt
     8761 ggccgaatcg tatgggtccg gcgaccccgg aaccccctac aacccgatgg gatgacgcca
     8821 tgaaactggt ttcgatgaag aaagagggcg ggcacgggaa ggattgctgc tgctgcgacg
     8881 ccgccccgag cggctgcagc gagccggatt acccgtgggg cacgcgcatc agcctggaag
     8941 aagaccagat cgcggccctg ggcttgaaat ccatgccggc ggtcggcgcc ccggtcggcg
     9001 tggaagcggt ggccatggtc atcggcgtga atgaggaaca gcgcgacggc aagaccttcc
     9061 gccgcctgga actgcagatc accgatctgg ccctggccgc cgccggcacc aacaagtacg
     9121 cccgcatgta cgcggacgac cccagcatga aggactgacc accatgtgca gcagcgcccc
     9181 caaagtgaaa cccgtagcat cggcgcccgt cgtcggcccc gaatcagtgg atgatgccgc
     9241 tgtcgccgag cgcgaccgcg agcgcaaccg gatccgcgcc cgcggcggcc gccagtccac
     9301 catcttggcc ggcaacaccg atccgtccgc caccccgacc gcgcccgtca agacggcgct
     9361 gggggtgtga acgtgcggaa gactcgccaa tacgctggtc gccctctggt cgccgcgctg
     9421 ccgtgggcca tccgttctat cctggtccag cagggcgcgc acgaactgcg cccgttcggt
     9481 acctgacagg ggaagccatg gacatcgaca ccgcccgcgc caagctcgac gccgccgcgg
     9541 cccagccgac cctgcagctg cgccagcact gcgaccggcg ccgggcggcg atgattgccg
     9601 cgcgcgaaac ctggatgccc gactggatgc aggtgaccga gtacatcgac ccggcccgcg
     9661 gccagttcaa cggcgagggc accaccagca ccaggaagaa gcgcagccgg tccaagatca
     9721 tcaacggcac cgccacgaag tgcgtgcgcg tggccactgc cggcatgtcc tcgcacatga
     9781 ccagcaaggc ccggccgtgg ttcaacctga ccacgccgga tccggccatg ggccaggtgc
     9841 aggacgtgcg tgtgtggctg gacaacgtga ccaccatcct acgcgacacc ctggcgaagt
     9901 cgaatttcta caaggccatg ccggtctgct acacggaaga cctgtcctac ggcgtggcgg
     9961 ccatgatgat cgtggagaac cccgaagagg tcgtgcgctt ccacccgctg accatcggca
    10021 gctatgccat cgggctggac gacgccggca aggtcgattc gctgtggcgc tgctacacga
    10081 agaccgcgcg ccagctggtg cagaagtacg gccggctgga cccggagacg gggcagcgcg
    10141 tgcccgacga atcgaagctg ccccagcgca tcatccaggc gtacaagcgc agcccggacc
    10201 aggaattcac cgtggaagcg ctgtatgagc cgaacccgga cgcgcgccct ggcatgggtc
    10261 cgctgggcgt ccaggcgtcg aagttccggc cgttccgcga agtggtgtgg atcgccggca
    10321 gcggcgacga aaagcacggc gtgctggaca tcggcgggca ctacgaacag ccgttcgtgt
    10381 ccatccgctt caacccggta ggcgatgaca cctattccgc atgccctggc accgactcgc
    10441 tgggcgacat caagcagctg cagtatctgg aaggccagaa gctgcgcctc atcgacttga
    10501 tggccgaacc gccggtcagc gtgccggaca ccatgcgcaa catcggcgcc agcctggccc
    10561 cgcggacgaa gaactacctg ccgcagaatc agaacggcgc caagatcgaa gccacctaca
    10621 ccccgcagcc ggggtcgctg cagtgggtgc agcaggaaat ccgcgaggtc gaagcgcgca
    10681 tccaggattc gttctactac aacctgttcc tgatgctgga atcgctgggc gaggcctcgg
    10741 gccggacggc cacggaaatc gccgagcgca aggaagagaa ggccaccgtg ctggggccga
    10801 cgctggaaat cgtcaccgac gaaggcctgg accccaccgt ggtccgggtg ttccgtctgt
    10861 gcgagcgcgc cggcctgatc ccgccgccgc cggccatcct cgccagcatc ccgttgaaga
    10921 tcgagtacac cagcatcctg gcgcaggcca tgaaggcgtc cgggaccagc ggcatcgagc
    10981 gcaccggggc gttcgtggcg cagatggcca gcgtgttcgg cccggaagtc atggacaagt
    11041 tcgacgccga ccaggccgtg gacgaataca gcgagcgcac gggcgcgccg gccagcatca
    11101 tccgcgacga cgatgccgtg ctgaccatcc gccagggccg cgcggcccag caggcgcagc
    11161 aggcggcgct ggccgcggcc aaacccatgg ccgatggcgc ccaggcgatc aagacgctga
    11221 acgaagcggt gccgcagccc ggaagcctgg gtgaaggcct ggccgaacag ctgcgcgggg
    11281 ggcaggcagc atgacgcacc ccgccgaccg cgacgccatc gaggcccagc agcgcgccga
    11341 gcgccagggc gaaaagtggt tccaggaaca gctgcgggct gacgtgcagc aggtgatgaa
    11401 tctgccggcc gcgcgtcgta tcctgtggct gttcatgcaa cagaccgggc tggacgcttc
    11461 cccgttcgcc accaacgcca tggcgcagtc ccacgcaatc gggatgcagg acgccgcgaa
    11521 gtggtggctg aacctggtgc gcgaccactg cccggagaaa gaagcgcaga tccgccggga
    11581 aggcctggcg caggccaagc cgaaaaccaa cgaccaggaa cccgaagaat gaataccgaa
    11641 aacaccgaca ccgccaacag ccagcaaccc aatcctggcg aaggcgcagg tgcagccacc
    11701 gatgcagcga acccgaacgg gcagtcggcc accgcgccgg ctgcagcgcc aggtcagggc
    11761 gagggtggcg agaagaccgg cggcgacgcc ggcaaccagg gcgaccaggg taagacgggc
    11821 gacgaaggga agactggcga cggccaggac aagaccgacg atcagcagcc cgcactgact
    11881 ggcgcgcccg aagcgtacac ggacttcacc ctgccggacg gcttcaagct ggaaggcgag
    11941 cggaaggacg tggcgctgtc gctgttccgt gacctggggc tgtcccaggc cggggcgcag
    12001 cgtgccatcg accacttcat caagacggtg ggcgaggacg ctgcgatgca gcagcaggcc
    12061 atggaagccg ctgtggcgca gcagcgcgac gactggggca aggcagcgaa ggcggaactg
    12121 ggcgacaagt acgaagccga agtggcattc gccaagaccg ccgtgcatgc actgcagaac
    12181 ccgaagctgg tggaagcgtt cgatgaactg ggctggggca accatcccga actcatcaag
    12241 gcgttcgcca cgttcggcaa gctcatgcgg gattcgcctg tcgatggcat cggcagcagc
    12301 ggggccgcaa agccggacgc caagccgtgg aaccgcatgt accccgacat gtgacaccct
    12361 caaccctgac ctgaccacct gaaaaaggaa tcgcaccatg gcaatcctcg ccaacggcca
    12421 gcccaccctt gcggatgcgg cggccctgac cactgattcc ggcgccgctg tcaccatcgc
    12481 ggaactgctg gaacagacta atccggcctt caacgacatc ccgtgggaag aggccaacag
    12541 caccaccggc cacaaggtgt ccgcgcgcca gaagctgccg gaaacctacc tgcgccgcat
    12601 caaccagggt atccgcccgt cgaagtccgg ctacggttcc gtgctggaat cggccggcct
    12661 gttcaacgcg ctgggccagg tcgatgccaa gctggtggaa ctggccgtgg ataaggcccg
    12721 tttccgcttc atcgagaaca agggccacat cgagtcgatg ggccagcgct tcttccagtc
    12781 catgctgtac ggcgatccga acgtggtgcc ggaagacttc ctgggcatcg cgccgcgtta
    12841 cgccagcctg gccgccgccg accgcaccgc cgtgcagatc atcgacgcgg gcggcaccgg
    12901 ttcggacctg accagtatct acctggtcgg ctggggcgaa ggctcggtga tgggcttcta
    12961 cccgaagggc accaccgccg gcatcaagca cgttccgctg ccgcagaaca tgatcgatga
    13021 tggtaccggc ggcaagtacc tgggctatga agactggttc gacctgaatg ccggtatcgc
    13081 ggtcagcgat taccgcaaca tcgtccgcat cgccaacatc gacgtttcgg acctgcaggc
    13141 cggcgatccg atcaccggta tcaccgcggg cgccaagctc atcaacctga tgaccatggc
    13201 cctggaacag ctgaacaacc cgaacggcct caacccggtg ttctacgtgc cgcgcgtggt
    13261 gtccacgttc ctgcgcctgc agatccagaa caaggcgaac gtgtggctgt ccacccgcga
    13321 aatcgcgggc aagaaggtca cggacttcga tggcgtgccg gtccgccgta tggacgccat
    13381 ttccctcaac gaaacccgcg tcgtcgtcta atcgacggcg ccggccattc acaaggaatc
    13441 gaacccatga tcctcgatca gctgctgtac ttctccgaca accaggccgt gaccgcggat
    13501 gccatttcca acgtcatcga ccgcggttcc accgccccgg tgctggccaa cttctcgccg
    13561 ggcttcgctg gcgatctgtt cctggtcatc cagaccggca ccgccttcgc gggcgccacc
    13621 agtctggaag tgaagctggc ttcggacagc accgccgacc tggcgacctc gccgaccacc
    13681 cacgcttcca cgggcgccat tccggtggcc aacctgggcg cgaacaaggt ggtggcggtg
    13741 ctgccggtgc cgccgggcga ctacgaacgg tatgtcggcc tcatctacga tgtgaccggg
    13801 accggcaccg ccggcaccat ccgcgccttc ctgacgcaga cccccggcta ctggcgcaag
    13861 atggcggcca acaacccgca ggctcgcaac tgaccgccct ggatccggcc ctacggggcc
    13921 ggctccactg accaaggaac cgcaccatga gcaataccaa ggcactgaac ccgcggaccg
    13981 cgcgcacgcc gtccggcggg gaacagcagt acgtcatcgc ccacggcgcc ccgacccact
    14041 acgtggacgg ctatagcctg tgcaacgcgg gcgccatcgt caccctggca ccgggcgtca
    14101 cgccgggccg ctggtatgtc gaagtggccc cggaagacgc ggagaaggcg caggcatccg
    14161 aaactgacgc ccagcgcctg gctgttctgg ccgccgccaa gatcaaggcc aaggccaaca
    14221 gcgaggacgt gagccgcaag caggccgccg accaggcagc gcaggcgcag gccgcagctg
    14281 acgcccaggc gaaagcccag gccgaagccg atgccatcgc caagctggcc gcggccgacg
    14341 ccaaggctca ggccgccgct gaccaggcca ccgccgagaa gacccgcgcg gatgaactgc
    14401 aggcgcagct ggacaaggcg aacgccgacc tggccgccgc gcagtcgcag ctggaaaagg
    14461 tcaacgccgc cgcggaagcc gacaagggca agggcgagtc gaaggccgac gccaagcagg
    14521 ccggcaacgc caagtaatcc ccgcctcccc ggcgggcgtg cagtcggggt cggcgtattg
    14581 ccggcccctc tttttaggtg atgaccgtgg ccacgcagac cgacattttc aacctggcgc
    14641 tgtataagct ggcgcagtcc atcgccattc cggcggtgac cgacgaatcc aaggccgccg
    14701 acgtgatgaa ccggctgtgg gcgccgatgc gcgacctggt gttgacggaa cgcgtgtggc
    14761 cctgggcgat ccgctcgcag gcgctggcgc tggacgtgga agccgcgcag cccggatggg
    14821 gctaccgcta cgcctatccg aacgactgcc tgaccgccta cgcggtgacc gacgccaacg
    14881 gcatcgccgc ggccggcaag ctgtcgcgct tcacgaacgg cgactacatc gccagcgtgt
    14941 ggggttctgg cgccttcgac tgggacacca gctacggcga ccaggccacc acgatcaaca
    15001 cgaacgtgcg caacgccttc ctggtgtatg cctgccgcgt cgaagacacc ggccggtatc
    15061 cgccgcagtt cgtcaacgcc ctggcgtgcc gcatcgccgc cgaagccgcg ccgcccttga
    15121 tcggcgaagt gggattgaac aacaagaccc agctgctgca ggaatacacc ctggcgctga
    15181 ccaacgcggg cgcgcacgcc atgaacgaat cgcggacgga cgccgactac gtgacgccgg
    15241 ccctggccgc gcgcgacagc aacgtgtggc cgggccgggg gccgtactga catgcccaag
    15301 ttcctgcagc cttctctgtc cggcggcgag ctttcgcccg gtatgcgtgg ccgcgtcgat
    15361 ctggcgcgct acgcgatcag cctgggcatg gcccgcaact tcatcaccaa gccgaccggc
    15421 ggcggcgcca agcgccccgg cacgatcttc cgcggccggg tgaagttctc caacaagctg
    15481 acgcgcctgg tgcccttcat ctactccacc agcgtcaaat acttgatcga aatgggagac
    15541 gggtatttcc gcttttgggt caacggcgcg ctgctgacca acgcgcagaa gcccatcgaa
    15601 gggatcagcc aggcgaatcc cgccgtggtc acgtccaccg ggcacggcta cgttgccggc
    15661 gaccaggtgg tgattaccgg cgtgcgcggc atgaccaagg tcaacggccg caccttcacg
    15721 gtgacggtgg ccacggccaa caccttccag ctggccggct tcgattccag catcctgacc
    15781 gcctatgccg gcggcggcag cgccgaccgc atcgtggaag tggccacgcc ctacgacgaa
    15841 gcgaagctgc gcagcgtgcg cttcacccag tcggcggacg ttctctacat cgtccacggc
    15901 caggtgccgc agaaggaact gcgccgcctg gcggtcaacc agttcgaact gcgcgacttc
    15961 gcgttcaagc gcgggccgtt ccgcccgttc aatagcgacg aagcgctcat catggccgtg
    16021 tctggcacca ccggcatcgt cacggtcagc accaacgtgg acaccttcac cgccgacatg
    16081 gtgggttcgc tgctgtacgt cgaggaaaag gaactgcgcg gcgtgaagcc gtgggcgtcg
    16141 gccgaaaaga acgtgccggt gggcgcgctt cgccggtcgg acagcaaggt ctaccgctgc
    16201 gtgagcattc cggccagcct gggcagcaag ggcacgccct actgggtcgc cggcaacgtg
    16261 cgcccgatcc atgacagcgg ccgtgccttc gacggtccgc aggacatcaa ggacgacggc
    16321 gtgaacagct acgcggtcgg cgtggaatgg gaattcctgc acaacacctt cggcatcctg
    16381 caggtgcagt ccttcactga cgcgcgccac gtgcaggcgg tcgtgatcga gcgcgtaccg
    16441 gacagcatcg tgggcaccgc gccggcaccg gccaatagct ggacgttcag cggcgacggc
    16501 accaccaagg tgttcagcat cacgggcgcc ctgagtggtt cgaccctgga ctacaaggtg
    16561 aacatcgacg gccagccgat ccagccgaac ccgtactacg gcggcggcgg cggggtgaat
    16621 ggcagcggcg gcggcagcgt gcgccccggc ggcaacagca acgtgcaaca ggaggcgctc
    16681 taatggcgca gggctggact atcaacccca ccgcggacac gatcaccttc tacgaagcgc
    16741 cgccggttgg gacgaacaac atcctggtga acgaactggc cgatgctggc cagggtggca
    16801 ccgacgtgtg ggcggtcggc tcctggtcgg gccgctacgg ctatccctcg gaagtcgaat
    16861 tcttcgctga ccgcctgtgg ttcgctggca ccccggcgga cccgcagacc atatgggcgt
    16921 cgtgcatcgg cgattacccc aacttcggcc ggtcctcgcc catcgtggac agcgacacgg
    16981 tgacgttcgt catcaacgcg cgccaggtaa acacggtgaa agacttggtg ccgctggaca
    17041 acctgctggt gatgaccacg ggcggcgaat acaaggtcac gggcgggcag gacgacgtgg
    17101 tgacgcccag caccatcggc gtcaagaacc agggcaatgc cggcagcggc gatgtgcagt
    17161 ccaagctgat tggcgagtcg gccatcttca tccaggaaga gggccagaag atccgcgatc
    17221 tgcgctacca gttcgaaaag gacggcttcc gcggcaacga catcagcgtg tgggccgatc
    17281 acttgttcgc tggcttcgaa gtccagtgga tcgaatactg gaaggcgccg tggcaagtgg
    17341 tgtggttcac gcgcgacgat ggcgtgcgca tcggctgcac gtacatgccg gaacaggagg
    17401 tcgtgggctg gcactggcac gacaccgatg gcctgttcct ggacgcctgc gcgctgccgg
    17461 gcaagaagga gtcggaatgc tatttcctgg tggaacggtt gatcgacggc gaagtggtgc
    17521 agtgcatcga acagcaggcg ccgacccgcg caaacagcga atcggatatg tggttcgtgg
    17581 actgcggtgt gcagtacgac ggccggaacg cgaccgccac cacgatccag ctgggcagca
    17641 ccgccggctg gaccgaacag gacgaactga ccatcaccgc ttccgccgcg ctgttcgtcg
    17701 gcgccacgga tgtcggtgac ggcttcgaac tgtggcgcga cgtgaccacg gtggaagacg
    17761 gcatcgccag caccgcgcgc gtcaaggtgc ggctggtgat cgactcctac gtggacgcca
    17821 cccacgtcgt ggcgcgcagc atcggcacgg tgccggcggc gctgcgcggc gtgccgctgg
    17881 ccagctggac gttccagcgc gacaccatcg acaacctgtg gcacctggaa ggcaagcgcg
    17941 tcgtgctgtt gcaggatgcc gcggtggccg gcccgtacac cgtgaccggc ggcaagatcg
    18001 gactggccac gcctggcggc gtctgcaaca tcggcctgcc ctacgcctgc gaggtcgaaa
    18061 ccctggaatt gaattcgccg ggcggcgatt cgatgcgcga tcagcagaag ctggcgtaca
    18121 aggtcagcat cctgctgctg gcgtcgcgcg gggtgaaggc cggcggcgtt acggacaagc
    18181 tctacccggt gaaggaacgc cgcttcgaac cctacggcca gccgccctat ctgaaaaccg
    18241 gcgtgttcga ctgcgacatc ccggcaggct ggggcgtgga tgccgggcgc gtgcgcatcg
    18301 tgtcggatga cccgctgccc atggaaatcc tgtcgatcac caccagggcc gtgtcgtcca
    18361 acggccaggc cggcggcgct gggggcaagg gatgatccgc gccaccatcg tgccggcaac
    18421 cgtggaacat gcgcacgcca tcgcggagaa cccgcgggcg gcggacctgg ccgaactgtg
    18481 ggcgtgcagc cgcagcgacc cgctggatgc gatgctgcgg ggcatggaac gcaccgccga
    18541 acccttcacc gccatataca acggccgccc cgcctgcatg ttcggggcgt cgccgttctc
    18601 catcatgggc ggcatggggt cggcctggat gatcggcagc agcgtgctga accagcacgg
    18661 cgcgcagaag gatctgctgc ggctgtcgga acccgtggtc gaatacatgc aagaccagtt
    18721 cccgaacctt ctctacaatt tcgtggatca gcggaacatc gcagcgatcc gctggctgcg
    18781 ctggctgggt ttccagttca gcgatccgat tgcctatggc gtggacggct tgccgttcct
    18841 gcccttctat cgccgcaggg gtgtgtgatg tgtgagccga ttaccatttc gaccggcgcc
    18901 gcctgggcac tgggcgcggc agcagcggcc accgccgcgg ccacgtatgt gtcctatgac
    18961 gccaacaaga agaccggcga agcgaatgcc gagattgcgg ccaacaacgc gcgcctggcg
    19021 gccgacgacg cggctgcagc ccaggccatg ggcgaccgcg aatcccagca acagacctgg
    19081 cgcacgcgcg cgatcatggg ccagcagcgc gctgccatcg cggcaaacgg gatcgatgcc
    19141 gggatcggga cgccggccga aatcctgggc gaaacggcgc tgttcggcga ggttgaccag
    19201 caggccatcc ggctgaacac cgcgcgcacc gcctggggct tcaactccca ggtgcgcaac
    19261 atccagaacc aggccggcat cgaccgcttc aacaccaggg ccaagggcac cgccacggtg
    19321 ctttccggca tttccagcat cgccagcagc gccggggggt tctacgggta atggccacca
    19381 tcattccgcg cgtcaccgcg ccccaggtcg aagtccagca gggtccgcag gtacgcaaca
    19441 ccgcgcgcgc cgatgactcc ggcgcccagg cgctggccgg cgccatcggc agcttcgcgc
    19501 gtccggccct ggaatacgcc cagcgggaac aggagcgcaa cgacaccacc gcggtgatgg
    19561 ccgcgcgcaa gcagctgtcg gactgggagg ccaacacgtt caaccctggc aacccggacg
    19621 gcatcgggaa gtacaagggc aagaacgcgc tgggggccga cgaagtgctg ctgcccgacc
    19681 tggacaagac ggtgggcagc atcagcgccg gcctgacccc gaagcagcgc cagcagttcg
    19741 aaggcgtggc catgaacttc cgggacagcg tggccggtcg cctgaacgga tacatggacc
    19801 gggaacactc cggctacatc accgccgagc agaaggcggc cgtggacaac ctgggcgccg
    19861 atgcggtttc cgctggcgtg tccggcgact tctctcggca ggaccgtgtg gcgaacgaac
    19921 tgctggccat gaaccgcgcg cgccgcgaag ccgatggcat gggcgaagaa ctcatcaagg
    19981 ccgaggaacg cggcctggtg tccagcgtgc ggtcgcagac catcgaaggc atggccaccg
    20041 cgcacccgtt cgaagcgcag gcctacttcg aacgctatgc cgatcagatg accccggaag
    20101 accgtgcgaa ggtggatcgc ctgctgtacc cggtcgtgtc cgatgccgcg gcccaggacg
    20161 acgcagatgc gatcctggct ggcgcgcagc cgcaggcata ccgcgatccc ggtccgcgcg
    20221 ggcgcggccc gtcgccggcg atggccaaga tcctggacga agaggccgac gccgcaggcg
    20281 tgccgcggga atacctgtac gccctggccg aacaggaatc cggcttcaac cccaacgcgg
    20341 tcaacccgga agtgctggac gacggcgaca acgccaccgg cctgttccag taccgcgcca
    20401 ccagcgccca ggggttcgac cggaaggatg cccgcgcatc ggcgcgcgct gccgcccgtg
    20461 agtttgccca gcgcgccaag accggcggcg tggaattcgc tgtggccgcc cacttcgctg
    20521 gcgagggcgg cgccgccgcg gtcgtgcagc gcgggcgccg cgccgagaac ccgaagaccg
    20581 cccggtacgt ggaagaggtc atgggccggg cgtcgcgctg gcgtggcgat gctcccgtgc
    20641 agcaggtggg ccgcaccgcg ccgccgagcg aggccgacgc catcgagcgc gcgcaggcca
    20701 tcccggaccc gcgccgccgt gccgccgtgg tgggcaagat ccgcgagcgg ttccagctgt
    20761 ccgatctgcg ccggcaggaa gaggaccgcg ccgcgtcgga aggcgcttac acggccatca
    20821 accaggccag caacccgaac gcgccgctgc gcgaaatcct gggcgcccag gtgtacgcgt
    20881 gggccgagcg caagggccat ctgcccacgc tggaaaacct gcggaagaac aaggtagccg
    20941 gcaccttcac ccaggatgac gccgtgctgg tcgaatccct ggaacgtgag gcagttctgt
    21001 cgccgcagac cttcgcgcac cgcgacatcc atgcgctggc ggaccgcatt tcgactgaga
    21061 cgctgggcga tctgctgggc aagcagaagc aggcgaacga tccttcgaag cgcgccgatt
    21121 gggccagcca gtcccagcgc atcgaatcgg gcctgcgcat cctgggcctg gacgaagccg
    21181 gcgacaaccg caacgccgaa ggcgaattcg tggccaagcc gccgaagaag aagctggacg
    21241 aacgcaaggt gcagcgcgcc cagttcgccc aggtgtaccg cgaggccgaa cgcgccttca
    21301 tccagcgcaa cggcaaggat ccgaccccgg cggaagccga ttcgatcctg cgtgctgtcg
    21361 tgcgcaacgt ggccaccgac atccccggca agctgcgccg ggctggcgcc atcgaagggt
    21421 tcggcgctgc gctgccggcc gccgaccggg cggaaatcat cagcgacttc cgtgcatctg
    21481 ccgggcgcga cccgaccgaa gccgaaatcg ttaggattgg ggcacggtat cggatgcagt
    21541 ccaacagcgc ggggtcgaac tgaacatggg gaagtattcg gaaatcatcg cggcaaccca
    21601 ggccgaagac gcccaggcgc gcgcccgcgc cgcgggcatc acggcgccgc aggtggagcc
    21661 ggacgcgatg ggccgggcca tgcgcctggc cgatcagcgc ggcctgccgc ccggcgtggt
    21721 cgccgacaac ctgcccgaat acgaccagca gcagcagctg gacgccctgg gcgacgctgc
    21781 cagcgcttcc ccggcccttg cgcgctggct gggcgacccc aaccacacgg cgctgtccaa
    21841 ggacgacacg ggcgtactgg cgggccttgg acggcagttc aacagcgggc tgctgtcggc
    21901 gaaggaaacg ctgccgtggc tcccgctgcc gcagtctgcc ctggacctgg acaaggaacg
    21961 caaggccgcc gccgcgcgcg ggccgcagat gatggccagc ccggacccgt cgtggttcag
    22021 cgaactggtg ggcaagttcc aatccggttg ggagcaaggc aaggcggggg ccggcctgct
    22081 gccgatgccg gaccttggca gcgccagttc gcgcgcaatc gaagaacagg tggcccgcgg
    22141 cctggggtat caggatgcgg ccaactacga cgcgacccgc accgcggtgt acgtggccga
    22201 ccagcagcgc cgcgcgcagg ccgccgacgt ggaaaccgcg gcgaccgcgg ccgggttcca
    22261 ggaaattgcc gacgctgaga aaacgaagga caccggcaag atcgcgcgcg ccgtggtcac
    22321 gaatccgcgc gcggtgatgg ccgtggtggc gcagtcgctg ggcaacaccg ccccgcagct
    22381 ggcgctgtcc gcggcgatgc cggccagccg tgtcgtggcc ggcgtcacgg cgggcaccgg
    22441 ctcgttcgcc accgaacagg gcatgaccat cttggacgtg atgggcgatg ctggcgtgga
    22501 aaccagcgac ccggccgcgg tgtccgcctt cctgcggaac aagccggcca tggagaaggc
    22561 ccggcagaag gcgctgacgc gcggcgtggc ggttggcacg ttcgacgcgc tcacggctgg
    22621 gtttgcgggg cgcttgctgg cgaatagccg tcgcacggcg gcatccatcg gatcgcgtgt
    22681 ggtcggtgaa ggcctggtgc aggctggcgg cggcgcagcg ggcgaagcta ccgcgcagct
    22741 ggccagcgaa ggcaagatca ccagccagtc ggacattctg ctggaagctg cggctgaggt
    22801 tcccaccttc ctggccgaag gccgcgggca gatcgcagaa gcgcgccgcg cggcaatgca
    22861 caacgccgac cgcttcgacg cccaccagga acagcgggcg atcagcgacc tggtgaacct
    22921 ggcgtcgcag tcgaagacgc gcgagcgttc ggccacgcgc ttcgaatccc tcatccggga
    22981 catgaccagc gagggcgagg acaccatcta cctgtcggcc gatggcgccc agcgcctgtt
    23041 ccagtcggcc aacagcgagg gcggcccgga cctgggcgcc ttggtggatg ccgacgccct
    23101 gcgcgaggcc atcgctaccg gtggcgaagt cgctatcccg ctggccaagt acgccaccct
    23161 ggtcaccccg gaactgcacg cggccgtggc cgatcaggtg cggctgcagc ccggcggccg
    23221 ccacgatctg ccggcggtgt cgtcggaaga aatccagcag gccatcgacc aggggctggc
    23281 cgaagcgcag cagcaggacg cgcgcgagaa cgggccggcc ggccaggtct acgacgacgt
    23341 ggtggggcag ctgctgtcgc gccaggacga acagctggcc aggcagaacg ccagcgtggt
    23401 gcagtccgtc taccgcaacc tggccgagcg tgtgggcacc gacgcctgga cgctgtacca
    23461 gcagttcaag atccgcatcc ccggcgcgac caccgacacg cgcgcccgcc cgcgcggcgt
    23521 ggacatcgac gtggacccgt tcctggacgc gctccgcagc ggcaagatgc ccaccgaccg
    23581 cgagatttac ggcgacacgc tggtgtcggc gctgcacgcg gccggtggcc tgagcgactc
    23641 cggcggcgaa ctggccaaca tggatgccgc caaggcgcgg ccgggcctgg tcaacaacct
    23701 ggccggcatg agcctggacg atgccctggt gtgggcgtac caggaaggct tcatcaccca
    23761 ggcaccgacg aaccagcagg aaggcagcta cgacgccgac gcaccggaca tcaacacgct
    23821 gctggatctg ctggcccagg atcttggcgg caatccggtg taccgccccg cggccatgaa
    23881 tgccgagcgc gccacgttcc gcgaccgtgc ccagtcgctg caggatgagc ttgaccagcg
    23941 cggcatcgac ctgcagcagg cggacaacgc gaccgcgcgg caggcgctgg gatacgcgaa
    24001 ccgcatgctg gaacagggcc agccggtcga acccgatgcg gtggactacg ccgtgcgcga
    24061 cctggtggcg gggccgagcg gccgcccgga aagcgccgcg acgcgcgcgc tggtggacca
    24121 ggcggtggcc gatggcgacc tggccaagat gctgcagggc atcgccgccc aggaagggat
    24181 cgatgccgac caggccgcgc ttgcgctgcg cctggctgaa atcacgcccg acctgaacgt
    24241 gacgatggtg gcggcaccgg ccaacgccaa cgccgccggc atctacaaca acaccacgaa
    24301 cgaaatctgg atccaccagg cggtgccgtc cgtggtgctg cacgaagtcc tgcatggcgt
    24361 cacgtcggcg atgatgacca gtccgaccct gcgccggtcg aacgcgaccg tggcgcgcgc
    24421 cgtggccgag ttcaacgact tgctgggcgc cgcccaggcc cacttcgctg gcatggaaac
    24481 cgatggcgcc gatgtgccgg cggcgctgcg cgccacgctg caggatccgc gcgggccgct
    24541 gtcgaacatc aaggaactgc tgacctacgg catgaccgac aagcggttcc aggaatggct
    24601 tgccaccgtg ccggcgccgg ctggccgcga ggaatcgcgc acggcctggc agtggttcaa
    24661 ggacgccatt gcgacgatgc tgggcgtgac cgggcaggag cgcaccgcgc tggatgcctt
    24721 gatcgaatcg accagcgacc tggtggactt cgcccaggcc aacccgcgcg cggccaactt
    24781 cgcgcagatg agcgaggcca accggctggg cgctccgatc accgatgcag ccgctgcgca
    24841 gggtggaccg gcggaagcgt tccgcggcgt cacgcgcgaa cagttcctgg gcgagccgcg
    24901 cattacgtcg aacaccaacg ctgccgacct tcggccgcgg gcgctgcgcg aactggacgc
    24961 agtggattcc gtgccgttcg gcgacggcga cctgaccgca aagtattccg atggttcggc
    25021 cgccgtgttc gatggggaca aggtggtggc cagctacaac ttcggcgaca cgctggtggt
    25081 ggatcgcgca taccgtcgcc gcggcatcgg cgaagaactg gtttaccagt ggcgcaccag
    25141 gaacccgcag gcttcggtcg cgcgcgagcg caccaaggcg tcgcaggctt tgcaggaaaa
    25201 ggtgtgggac cgcatccagt ccgagcttgc cgccgatcct cggaccctca accagggcgg
    25261 cgagaagccg cgcggcgccg tcacgttcga aggcgtgccc ggcgcgcggg tgttcaacat
    25321 cgaactgctg aaaggcatgg acgccagcac cttcatgcac gaaatggggc acgtgtacct
    25381 ggaagtgctg aatgacctgg ccgcgcgcga tggcgcgccc gcgcagatca ccaacgacat
    25441 ggccaccctg aacgcctggc tgggccgcga ggccggcacc gcgttcaccg ttgaccagca
    25501 cgaacagttc gcccgcggct tcgaagccta cctgcgcgag ggccgtgcgc cgtcgtctgc
    25561 gctgcgccgc acgttcgccg cgttcaaggt gtggctgacc gcgctgtacc gcagtgtgcg
    25621 cagcctcaac gtggaactga ccgatgacgt gcgcaacgtc atggaccgca tcgtggccag
    25681 cgatgccgag attgaagacg cgcgcgccgg ccagtaccag ggggcgctga ttgccgatgg
    25741 catggctgtg ggcatgacct tcgaacagct gcaggcctac aacgaggcgg tgaacgcagc
    25801 gcgcgccgat gccgaagcca ccgtggcggc cgaagtgctg ctggccgagc ggcgcgagca
    25861 acaggcgtgg tacaaccgcg agaagcggga agtgcgcacc caggtgttgg aagaggtccg
    25921 caacctgccc gtgtaccgcg cccagcgctt gctgcgcaac ggcaaactgc cgaacggtga
    25981 tctggcgccc gatgaactgc gcgtcaagct gtcgaaggac gaactgctgg acaagttcgg
    26041 gcaatcgttc ctgcgcaacc tggtcggcat gtactcggtg gaaggtggcg tgcgcgccga
    26101 cgatgcggcc gccatctacg ggttcgggtc cgggcgcgag ttgatcgaat cgctggtgaa
    26161 cgcgccgcgt ctggccgacg ccgtggccag cgaaaccgat gcgcgcatga aggatcggca
    26221 cccggatccg atgacggacg gcacgctgcc cgaccgggca atgattgccg cgcaccgtga
    26281 ccggcaggcc gacgtgatgg tgcgcgaaat ccgcgcgctg gaacagcacg tcaacgggcg
    26341 ccaggtgtcg caggctgcgg tcatcaaggg cgtggcccgg cagatcatcc aggacaagaa
    26401 gctgcgccac ctgcagccgg ccacctaccg ttcggccgaa gcgaaggccg ggcgcgaggc
    26461 gttcgaagcc gcggcgaagc aggactgggg ttccgccctg gccgcacgcc gccggcagct
    26521 gctgaacttc gaactgttcc gcgaggccgt gcgcgcgcgc gatgaggcgg cgcgcaccgc
    26581 gaagtacctg gcgaagttca gcgagacgaa gacccgcgcg cggctgggca aggccggcgc
    26641 cgactacctg gaccaggtgg atggcctgct ggaccgcttc gacttccgca agatcagtga
    26701 caaggcggcg gaccgccgtt cctcgctggc cacctggatc gaggttcagg cgcagaaggg
    26761 gatcgacgtg aacctgccac ccaagatcat ggacgaagca ttcaccattc cgtaccgcga
    26821 aatgaccgtg gcggacctgg ccacgctgcg cgatgccatc cggtccatcg atcacctggc
    26881 gcggttgaag ggcaagctgc ttctggccgg cgaagtgcgc gatgccgcgg aagtggatgc
    26941 tgccatggcc gccagcctgg ccgctgcgca cgctgcgcgt ccggtcacta cgggcgaccg
    27001 cgggccgaag gacaagctgc gccaggcatt catgcagggc cgcgtgatcc aggccacggc
    27061 gaccgacatg gcccgcgaac tggatgggtt caaggaccag ggcgccatct ggatgaacac
    27121 cgtgggcgtg atgcgcgatg cggtgaacaa ccggctgaac ccggcgctgc agcaggcgca
    27181 ggatgatctg gccaaggtgt acgtgaagca ctacacgaag gcggaaatcc gcggcttctc
    27241 cgagcgcgtg ccgatgcccg aagtgaacgg cgacctgtgg agcaagtccc gcctgctggg
    27301 cctggcgctg aattggggta acgccggcaa ccgcgaagcg atcctgaccc aggcacgcgg
    27361 gcgcatgtcg tcggaacagg tgaacgccct gctgtcgaag ctggattcgc gcgactgggc
    27421 gttcgtggaa gacgtgtggc ggttgatcga tgcgcagtgg cctgccatcg ccgaagcgca
    27481 gaagcgtcgc accgggctgg tgccggagcg cgtgcaggcc agcgccttca cggtgcagac
    27541 cagtgacggc aaaacgctgc agatccccgg cggctactac ccgttgaagt acgaatccga
    27601 ttccgtcaag accatgaagg acgaagcgga cgacttctac aacagcattc gcaccggtcg
    27661 caccgccaag gccgccacgc gcaacgggca caccatcgag cgcgtcggtt cgggtgggcg
    27721 cactgtgcgc ctggacacgg gcgtggtgca gcagcacctg cgcgacgtgc tgcgcgatgt
    27781 ccacctgggc gatgccgtca actacgtcca caacgtgctg aacggccagg aattcaagga
    27841 agccgtggac agcaccggca tgcaggaata ccggcaggcg ctggaagtgt ggttgaagga
    27901 tgcggcggcc ggcgagattg gcccgcgcgt gtggcacgaa cgcgccatgc gcgccgcgcg
    27961 ccagaacttc accgcctccg tgctgacgtt caaggtgacc agtgcgctgc tgcagttgtc
    28021 gggcgtcgtg cccaccatcg tcaccatcgg tcaggggcac accatggccg gcatcggcca
    28081 gtacctgggc aagccgcgcg cgatgacgcg ctacgtgcgc gaggcgtcgc cgtacatgga
    28141 cagccgcctg cgcacgcaca tcgaagcggt gcagaccgtg atggatgcgg aagccggccg
    28201 gttcgccgcg ggcaaggccg ccagcatccg gttcggttac tggatgatcg gccgcgtgca
    28261 ggggctggtg gacaccgtga cctggctggc agcagaacag gcgggcatgg cgaagttcgg
    28321 caacgacgtg gcgcgcgcgc gggcctacgc cgacgacgtg gtgacgcgcg cccagggttc
    28381 gggcgagttc atcgacaagt cgccgctgca gcgcggcacg ctgggcgaca acgtgcgcca
    28441 aaccgagtgg atcaaggcga ccaccgcgct gcagggctac atgatcgcaa aggggaatct
    28501 ggcctacgaa cagacccgca aggcgaatct gcgcaacccg cgccaggcga tgaagtgggc
    28561 cgccgacatg gtgatgctgt tctcggtcga aggcctgctg accgcggcgc tgaccgccaa
    28621 gctgccgaag gacgacgacg acgacggcct gtgggatgac ctgggcgagt gggccatcaa
    28681 ggatgcgctg tccaccttct tcggcgtgat ccctggcggc ggcgtgctgg tggaccagtt
    28741 ccgcggctac gattccagcg gcgtggtggc cggcgcctgg cgcgcctacg ccgaactgct
    28801 ggaaaaggtg acccccggcg aggatggcga agtgaacctg gacaagggcg tggcgaaggc
    28861 ggccgtgtcc gcggccggcg tcacgctggg cctgccatcc acccaggtca ataagaccat
    28921 cgacgccatc gcggcgcgcg cggacggccg cgacgtgtcg ccctacgaat acctgaccgg
    28981 ccccaagaag gaatccaaat aatgaccgtc tccgccaaca gccgccgccg cgagtaccag
    29041 ggcaacggcg tcacccaggt gttcaatggg ccgatggcct atgcgcgcgc gcacgtctac
    29101 gccttcctgg tgaaggggaa gacgatgacg ctggtgccca atgccagctt cgacgtggaa
    29161 aagctggggt acgaatcggg cacgcgcgtc accatgcaca cgccgccggc cgctgacgaa
    29221 atgctgctgc tgctgcgcac gatgccgtac acccaggaaa ccgacatcac gaaccagggc
    29281 gcgttccacg cggaaaccat cgaaaagggg tttgatgcgc tggaaatgca gatccagcag
    29341 ctggtcgatg gcacgatcca gctggtgttc gaagatggcg aattcgtgtg ggatgcgaag
    29401 ggcagtcgca tcatccgcgt gggcgacccg actggcgatc aggacgctgt gaacctgcgc
    29461 accctgtacc tggtcatcga acagatccag aacggcggcg gctcggtcgg cgtcagcccg
    29521 aaatactggg aaatcacggg cgacggcgag gataccgact tcgaactgcc cggctccgac
    29581 gtgtcggatt tgctcttcta cgacgtggtg gtggaaggcc tgtcgaagga gccttacgac
    29641 gaatacacca tcgttgcggc atcggatgga tccgacttcg cggtgcggtt cccggcgccg
    29701 ctgccgaacg gcgccgaagg cttcgtgatc ctgcgcggct atgccaagcc gttcacaggt
    29761 aacaccccgg tgcagacgct gcgcatcccg atcatcgacg tggatgccac cacgtacacg
    29821 gtggacaagt ccagcgaatt cgcgctgctg cgcaccacga acgtcaaccc ctgcctgctc
    29881 actctgcgcg cgaatcaggg cgatctgttc gacatggggg acggcagcta tttcagcgtg
    29941 tgccagcgcg gcgatggcca ggcccggatc gtcgccgaca ccggggtgac gttggtcctg
    30001 cccgaaggat tcgtgcccta cacgcgcgcg cccggttcga ttatctcggc cgtctgcgag
    30061 tacgcggagg gcgacacctg ggtgctgtcc ggcgacctgg cgcagggctg aaccatgacc
    30121 agtccgcaca tcctcttcac ccgcccgctg gggcttcgct tcgtcggcca gccgcccctg
    30181 caggtggtcg ggcagctgga cggctacacg gcgggcgaag cctacgaagg gcgcctgcag
    30241 atcatcaaca acatcggcga ctgcaccgtg cagtgggtgt cgggcacgat gccgccgggc
    30301 acgtcggtgc gcgtggacaa cagcacgcac gaagtggtgg tggcgtggcc cgaatacgaa
    30361 ccgccggacc cgaacaccac ggtggtcccc aatggcagtt ttgaagccgg tgacgtgaat
    30421 tggtccaagg gcgccggctg gctcatcggc caagggtcag ggttcgatgc ctacgacggt
    30481 tcgtggtcgg cggcttacac cggccgaggc acgtccagct tggaaggcac gcgcgtgcct
    30541 gtcgtggtcg gtaccagcat caccggcagc atccaggtgc agcagggcgg gtccagcaag
    30601 ggcaacgtgg tcgcaggcgt gatgctgctg tggtacgacg ccgccggcaa cctcatcgac
    30661 tacgacgtgg ggaacatcgt gcgctcgggc agcaatggcg cctggcacat ttccacggtc
    30721 acggcgagcg cgccggctgg ctccttctac gtcgccctgg gcgtcactgc caaccggaag
    30781 cgccagaacc ggcggctgtg ggtcgatcaa gcgcggtgga accattccta cgccagtggc
    30841 gccaacagcg acgacgacta ttgcctggtg atgctggtgc gcgacgcggc cgggcgcgaa
    30901 gcgatgtggg aagggtgcgt gggcgaacgc gcggtgttcc tgaccacgca gacctatccc
    30961 atcgacgcca tcgaagaact ggattccagc ttcgtgttgg atggcggctt cctgcgcgtc
    31021 ccaccggttc tgagcttgac cgaaggggca gacgccagcg cggtcatcat ttccggcgag
    31081 ttgcgcacgc ctctgctttc ctacgtgatg gcgccggaag gggttgatgc ggatgccgct
    31141 gtgatgtccg gtgaactgcg cgttgtccag cgctcctaca cgatggcgcc cgaagccgtc
    31201 gattctgctc ttgcaatccc gtccggcact ttggcccagg tgctgattgc cactaccatg
    31261 acgccggaag gcgttgattc ctcccttacc cttctttctg gaacgctcgc atgaaaaccg
    31321 aaatcacccc gttcaacgtg acgcgtaccg tggccgggcg gttcaagatc cacgcgcttc
    31381 gcctcgatgt agatgggaac gaaattcccg gaagccgccg gcttgctgcc gactggttcg
    31441 acaacctggt ggtgaacgct gggctggacc gcatgggcca ggcgagcgat tacctttcgg
    31501 cttgcatggt gggttccggc agcacggcgc ccgctgtcgg cgacacgcag ctgcagtccc
    31561 gcatcgccag caccaccagc atccagtccg ataccaatgg catggtggtt tctccgcggt
    31621 atggctggcg gcgcaaaacg ttccgttttg cggctggcgt cgccgccggc aacctttcgg
    31681 aagtgggtgt gggttggtcc actgtttcgg tgttcagccg cgccctgatt ctggatggca
    31741 gtggcaaccc gaccaccatc accgtgctgg ccgacgaagt gctggatgtc acctatgagc
    31801 ttcgcgccta cgtcaacgaa tcggatgtca ccttcaatgt ggacatcagc ggcgtgacct
    31861 atgcgtgcgt gctgcggccg gcgaacatcg gcggcagcca agggttgcag atcggcgacc
    31921 aggtgaccat caacacgtcg aatcgcgcag gcggcgtgcg cactaccgaa tccagcacgc
    31981 tggggtctgt gacttccatg cctagcggca cgcagagttc catgggcttc acgaacaacg
    32041 cgtacgtgaa tggaacctac tacaggaatc acacgctcac cgcggggttg aacctttcga
    32101 atttctccac cggcatcggc gccgtcacca tttccaacac tttcagcgac ttccagattt
    32161 cgttcacccc gaagatcccg aaggattcca cgaaggtgct gacgctgcag gctcgcagca
    32221 cgtgggcgcg ccatgttccg taacaacgcc ctttccactg tgccggtccc gtcttccttc
    32281 gtggagacgg tgagccggcg cacggtcccg ttgatcgact acgaaatggg cggcgtgaac
    32341 gtggccgatg ccatccaggg cttgaacgtc aagctgtgga agctggaatc gaacggcgcg
    32401 cagatgctgc tttcggccga tggcgtgccg gccatcgaac tgttcaaccg ccccaacgtg
    32461 tcgcaggtgg cgctggcctt cgatcagaat atgcgccccc acgtggcctt cgtgcagact
    32521 ggcgtgacgt ggctgtggtg gtacgacagc caggccggcg ccatggtgtt cagcagcttc
    32581 cccggtgcgc tgacgccgcg gctgaccacg gacgaaaagc gtccgacgca cctggaagat
    32641 tcggacgtga tcttggccta cgtgcgcaac aacaacctgt atttccgcat gcagcgtgat
    32701 cggttcctga ccgaatacct gttgaagtcg gcggtgaatg cagacctgat cgccataggg
    32761 atgaaccgcg actaccgcat gcaattccgg ctgcggccga acacatagaa gaagggccgg
    32821 gtgatccccg gccctttcct gttacgcctt cggtattgcc agcgctgttt cagcgtcggc
    32881 gatggcctcg cgcaggccgc cccactctac gcaatcaccg catggcggcg cgatgtggca
    32941 tccgcagttt ggcgcgggtg gcgtctcgat cactttcagc agccgttcca gggctgcttc
    33001 caggcttgat tcacggctca tgcgcgcacc gccagctggt agcggttgat tgccaggtcg
    33061 gcccggtcgc gcatttccgg gaagtcatca tccacgatgg gcgtgcggcg catgtcctgc
    33121 acggcaacga ttgccgcatc cgccagctgc aggcgcctgt ggtccgtggc cagcctgctg
    33181 aactcggcac ggaccgcctc cacgtcctgg atgtgctgcg gcgggcacca ggcgcggatc
    33241 ctggccagtg cggcgtgcgg tccgtcctct cgctccggca gttcttcctg gtcgtgctgc
    33301 gcgcagcggg cgaactggta ggcgtccagg ctcatcacga accgcagcgc catggcggcg
    33361 gtctggatgg cttcttcgcg cacgtcgccg cgcgttgact tgtgcggttc gtaggtgtgc
    33421 tgcagcacca ccttcgtcag ctcgccgaat tcctcgccca gcaccgccag ggcgtgcagc
    33481 ggatcggtcg gccaggtggg gaacttggtg gtggcgcggc gcagttcggc gagcgccagc
    33541 gccatcgggt cggtcgcctg cgaattactg ttcatcgtcg ccatcctcat cgtcggacat
    33601 gtagctgatt tcttcgtcgg cggtgtcggt gggatcgtcc cagcttcccg gctcgcgccc
    33661 gttatcgttc acctggttgt cgtgcagcat gatggcgtag gccgcggcct cgcccggttc
    33721 catgccggcc ttctcgcgca ggcgttccgc gcatttttcc agccattgat cgcgtgtcat
    33781 tggtatcccc tgcaggtgat ggcgccccgt tccggcggcg cctggtggtc agtcggcgct
    33841 gcgcgcgaac tgttcgatgg gcggtgcgtc agcggcgcgc tgtccgcctt cgggaaggcc
    33901 gccggccgcg cgcggcagcg tgtcctgcag gcggaacccc agcaactgcc acacctggtc
    33961 aacggcgcgc tggcgcgaat acttgttgcc cagttcggcg ttgaagttct cgatgctcac
    34021 gcatgctgac atgccttcga cggtgaaccc gttgtccagg gtcagctgac agaccgtggt
    34081 gcggccgttc ggcaggacgg tgtaggtttc tccgacgatg gccgcttcca cctgttccgt
    34141 ggtaacgcgc ggtgcgttac cgaatgcgtt actggtttcg ttacttccca tggtgctggc
    34201 ctcctgtggc cggtgatgat gtggttactt cgaaatgtct ttcagcagcg cctgcagctg
    34261 tcgcagcttc gcgctgtcct cgccgctgcg ctcgatggtt tccgccacgt cgatggccgc
    34321 ggcatccagg gcgtcggcct tggccagcag ctggcgcgcc tgctcgcgca gggtggcggc
    34381 aatctctgcc aggttggcca tcgggtcgct gctggtcggt gcgggcatgt cgtgttcctg
    34441 gggcgtgttg gtgggggtgc gagtggcgac caggcgtggg cgctgctcaa tgcgctggaa
    34501 ctgcccgtcg cattcgcgga tcagcccctg ttccttcaac gaacgaaggc acccatgcac
    34561 cttcgcgtgt tcgtacacca ggccgttccg gcccagttct gccgacacct gcgccagcgt
    34621 ccaaccttct tggatcggca ccgtgtcgta caccttccgg gcaatgccgg ttaggccgtg
    34681 gatgatggac tgcatgcggg ctgcgttcat gggtcgctgt cctcagaacg gaatgtcgtc
    34741 gtcggcgaag tcgtccatgg gcggcgcctg gcgctggggc gcctgctgct ggcgctgcgg
    34801 ggccggccgc tgcgcgcgct cgccatcggc agggcgggcg tccagcatct tcatctgatc
    34861 gcaggcgatg tcggtggtgt agtgcgtcac gccttccttt tcgtacttgc cgtaacggat
    34921 catgcccgcc accgcgatct tcgaaccctt gcgcaagtat tcgccggcaa tctcggccag
    34981 cttcccgaag aacaccaccc ggtgccactg ggtttcttcg acctggttgc cctcgcggtc
    35041 tttccgcttc gacgtggtgg cgatggaaat gcgggtgatg gccatgccgc cctgcgtgta
    35101 agtcaccttc gggtcatccc ccaggttccc gatcaaacgc acatcgtttt cgatattcat
    35161 gcttgcttcc ttggtgcggc gccgtggtgg ccaggcgcgc ccggttgaag gttgaggatc
    35221 gaccgcggcg aaatgcggcc tttgctggcg cagtcctgca tgttgtcgcc ctgggttcct
    35281 atgaacaggt ggtcggggtt gacgcatgct ggcgtgtcgc atcgatggca gaccatggcg
    35341 ccgaccggga tggcgccgac gtggtgttcg tagctgattc ggtgcgcttt gccgggagcg
    35401 gcaccgcggc ggatcgacac agtgccgtat ccgccgccgt ccttgctgcc ggtgtaaagc
    35461 cagcagccgc tttcagctac gcgcacacgc ttcatcatcc gcgggtatgg cggcgacggc
    35521 gtgcgcgcac ccatcaggcc atcgccttga tctgcgcgac cagcgcatcc agttcgcgga
    35581 tgaactgctg cagttcctga ttgagggtgg aaaggtaggc cagatcccga tgcacgcgca
    35641 cgcgcagttc gggcaggccc ggccagtagc tgcggaagtc gcaccactgc cggccggaca
    35701 ccagcagctg cccctggacc tgggccacgt gttcgctggg gagcttgccg gccagcacgg
    35761 cttcgatctg caggtgcggc agcttggttt tgatttccag caggccgtcg tcgcccacca
    35821 gggtgtccgg gctgcagccg atccggccgc ggcgcatgaa cccgacctgg cggcattcgt
    35881 ggtcgctggt ggccatgtag aggtcgcgca cctgtggttc catcacgtgc ccgcgctcgg
    35941 tgtgcttgtt gccgtcccag gtcggcacgt attccccggt gatcgtctcg gccgccagct
    36001 ggtacagcag cttcttgcgc gtctcgctgg gggcgccgtt gcgccccttg gcaagcacgg
    36061 tgtggaacac cgaagcggtg acgacgccgc agcgtgctgc gtgccattcg ggcgtgccct
    36121 gttccaggtc ttcgaaaatc tgcagttcgt caagcatcgg tcggttcctt ggtggcgtgc
    36181 gcatcgcgca tgtggtcgtg caggcctgct gccttgacgc gcttgccgca cgtcgggcag
    36241 gggatcttcg tggctttcgg caccgccggt tcgcggtcct ttcggcaccg cttgctgcag
    36301 taccgcgggt aaccgggcgc ctcgccgtcc agggagacgc cgcagccttc gcacagcgtc
    36361 ccgtccagca tcatgtcggc aatgtcaccc attggctgca ccttcctgct gcttggcgtc
    36421 ggccaccttc tgcttgcgga tccgccccag ctggtcgtga atccggttgt agcagtcggc
    36481 cggcacctct tccagcgcct ggatctgctg gttacggcat gcgccgcgca cccagtccat
    36541 gaacttgcct tcgttcacca cgtaggcgtc gatcaggtcg cgcaggatgg ccacctgttc
    36601 gtcgttgatg aactcgacct ggggagcgcc gcccaccacg ccatcatcgt ccatgtcctt
    36661 cgcggccacg ccggtcgccg acatcagggt gtagcgctgc aggtacgcca cggtgctggc
    36721 cacctgctgg atggcgtttt tcttgccgct gttgtccggc gccgcgaaca tttcgaccga
    36781 ctcgctgtga ccgtcgcggt gcgccacgat gcacgccacg gtgatctgtc cggcttcctg
    36841 cttcacgtcc cagcggtggg acaggccatg cttgcccagc gcggccacca cgccgtccac
    36901 cacatcggcc agggtggcgt gcttgtagcc gacgaatccg ccgtcgctgg tgctgtagcc
    36961 caccgccttc gtcttgcgga tgtcgatggg ttcggccttg aacgatgcca tggcggccac
    37021 gaacgccttg cgcgcctgct cggcgtccca tttcagctgc aggtccagca gcttttcgaa
    37081 ttggtccatg gcgcccttct ccatggcaat cacagccatc tgctggaagg ggttggtgga
    37141 gtgggccagc gcggtgttcg gcgccgactg cgtggtcggc atgctgtcca gcacgtcgcc
    37201 ttcgatgggg gtggtggtgg tgttcatgcg tgcatttcct tctttgctcg ggctacggcg
    37261 gcgcgcatac gggcgcgggc gttgttgtcg gtaacggcgg ctgcacggta ggcgcggtgt
    37321 agttctccgg tggcctcttc gaactcttcc gattcgcggt cttcgtcgga aatggattcc
    37381 ccttgtgcga agtcgtgaat ggcctggttc ctggccttct ttgcagcgat gcgggcggcg
    37441 cgggcgtcct gccattcaac ggcagcgacg gccacggcgt aggcggtttc cggcttcatg
    37501 cgttcaccgc ctgcgtgttg accacctggt attcgccgtt cacccagcct tcggcgaagt
    37561 cgtcatcgcc cagcggcttg gccggctcgt agattcgggc ttcgcccttc acgtcggacc
    37621 agttcatgtt atttgccgcc cagtcgtggg cctggtacgg gtcggcgtcg aacagcggca
    37681 gggtgtcttc ggccagggag cgttccaggt cgccgtcgaa ctcctgggcg tagtgcttcg
    37741 cgcggtcggt cgcaatgacc atcagcggca ccgcccagcg gcttccgtcc ggcatcgcca
    37801 ccacgtacag cagcgcagcc cggcgggatg cctcggcttc ggcctgtgcg cgcgcctgcg
    37861 cggcggcggc ctgttcggcg gcctcgcggt cgcggcgttc ctggttggcc ttctcctggg
    37921 cttcccgctg cgcctgggcg gcggcttcgt cccgctggcg ctgctctgcc gcctggcggt
    37981 ccagttcggc ctgacgcgcc gcctgctcgg cctggacgcg ctcgcgctcc acccggtcgg
    38041 cttcggcctg cgcggcgcgc tggcggtctt cctcggcctg gcgggcggca cggtcggcgt
    38101 cctccttctc ctgctgctcg cggcgcgcct tggcttcggc gtcggccttg gcctgcgctt
    38161 cggcggccag gcggtcgcgc tcggcctggg cggcttcgtc tgcgatgcgg cgctgctcgg
    38221 cggcttcggc gtcacgcgca gcctgttcct ggcgctggcg ttccagctgg gcggcctgtt
    38281 cgtccagcgc ctggcgctcg gccagcatct tgcgcagggc gtccagggcg gtgtcgcggg
    38341 tctgctgggc ggtcggcagg tagacttcat cgaagccttc cagttcatcg gtggccacgc
    38401 ggtcgatggc ctgctgcagt tcgtcggcgc tggcgcccac cgcctgcagc ggcatgttgc
    38461 ggatgttgtc caggcgcgcg ttcatgccgg cgatgcggtc ggcctcggcc tggcgcttgg
    38521 cttcgcgctc ggcttccttc cggtcctctt cggccttgat ctgcttatcg atggggtctt
    38581 cgatggccag gatggcgtcc ttgatcgtgc cggcgcgctc gttaatttcc ttgcccagct
    38641 tcgacagctg gctggtcttt tccttgcgga tgttctcggc cttatagcgc ggttcgcgga
    38701 tcgccgcgcg cgcagccttg gcttcgtcca tgcccttcgt ggtggtcacg tcgaacacga
    38761 cgcccttgta cttggcggcg aggtcagcca ggccggcttc cacgctttcc agttcctgca
    38821 tggcggcgtg gcgcagcgcc agggcgccgg ccttcgctgc ggtggtggcg tcctggtcct
    38881 gctcggccgc cgggtcgatt tcgtggctca tcgttcgatc cttggtgtgg tggtgatggg
    38941 gaatccatcc ggctgcggcc cgtgcccctc gccctgggga ggtagccccg cgtcttcggc
    39001 gttcgaacag cctgatacgg gtgggccgca gtcggatgga tgccggggtg ccgccccggc
    39061 gcgggtttcg gttacggggt gaagctaccg atggtcatgc tggcggcgtc gccgacttcg
    39121 cccagcagca gcgccttgaa ctgcttggcg atttcgtcct gttcctgttc cagggcgatg
    39181 acgcggaagc gcagcgacgg ttcgaggccg gtggtggaca ccgacacgcg caggtggaac
    39241 gtgcgttccg gcaggcccag gtacggttcg gtcttgaacg aaagcacgtc cggcaggcct
    39301 tcatcgctgg acgcagacac cgattccagc acgctgcgcg actgctggaa gttgccttcg
    39361 gtctgctcgg tggtggattc cgccttgatc ttcacgcggc ggatggcggc gatggcacgg
    39421 gccagcggga tcggggtgaa cgccccgtcg tcgctgacct ggtgcgcacc gatcaggtgg
    39481 gaccagtctt cgatgaagtc cagggcgtcg cgctggctga acgccttgcc gccagcggac
    39541 agcatcgcca ggtaggccgg ggtcgcctgc agggtcaggc gcgcggtgtg atcggcgtgg
    39601 cccggcttct cggcgtcgcc caggttgaag aacacggtgg cgcccagctt gtcggtgtcg
    39661 atgaagccgt gtccgcccac gcgagccttc acgtaggaaa cgaagtccgg gatgctgctg
    39721 gtggtcagct tgccgcggaa gcgggtgcgg ccagccagcg aggcttccac gttctgcagg
    39781 gtgacgccgt tggggacggc gaccaggtgc gcgatgctgg ccgggatctg ttcctgggtg
    39841 gccttggccg cggcggcgct ggaatcttgg atcgcttcaa ttgcgctctt gtccatgtgg
    39901 ttctgtttcc tgtgttggtg ttgcggtggg tgaatcggat tgggtgaagg tcagcggatg
    39961 gcggcgacgt tgccgctggc cacgccgtct tcgggcttga acagatcctt gttcgtgttc
    40021 ggcagcacgg tgatggcgcc gcggttgctg acgtacatca cgctgctggt ggaaatgtcc
    40081 tcctgcttct tgccgcgctg ggtcggcgaa gagaacttca cggtgtggtc gatctgcacc
    40141 tgggtctgat cgccaccgac cggggtgatg gtgaattcca gcgtcacctt gcccttcttc
    40201 gtctttgtgt tgcacgcggc aacgcccagg gcggattcgg ccagcgccgc ggccaggcgc
    40261 ggcccaaggg tgccgccatc cagttcggcc atcagggttt cgatgggggt gtggttcggg
    40321 ttcatcgctg ttgctccttc gggttggtgc cagccagccg gccggcgggg aaaaccgtgt
    40381 tgaactcggt ggtgcaggtg atggcgcggc gcctgcggaa cagctgcagg cgctggtcgt
    40441 tcgtcagcgg ctggcgcggc tctttgccat ggcgcaccag ttccaagctg gaattgcgga
    40501 acatgtcatt tcctccggga cgcatccacg atgaccacga acgtgatgcc aacccatatc
    40561 agcatcggca caaggttctg catgaagaag gccgccacca gggcggggcc aagaacgcca
    40621 tgcaaggcgc ccaggaacat gccgcgcgtg cgcatcagta catccccccg tcgtggtcgg
    40681 catggcgaga ctcgtaacgc gcttccgcgg cggcggcttc cgacgccgca aggtcagcat
    40741 cgaccaggct ttcggcgtcg ctgtgcagct gggcgcgcac ctgttcgcgc agcttgacga
    40801 agtagcggat ggcctcacca ccgaacgcag cgtctgaagc cagaagaacc gcggccatgt
    40861 ccgcagcgaa cagcgtgttg ccgtcgctac ccacgtcgct gtcgcccatc aggatgtcca
    40921 gcgcgctgcc gacctcggcg ctgctttcca tcagttcgtc cagcttcgtg tcgatgaact
    40981 cgccgcgcga gtcgttgcgg tcctggtcgg ccaggtagcg gtccaggtct gcggtcacgg
    41041 ggcaatggtt cactgggcgc cgtcctggcc tgcggcctgc tgcgtgcgct gggcgtcgcg
    41101 gcggttctgc ttctgccggc ccagttcgat catggtgcgg aagtgttcga tgtcgcgggc
    41161 gcttgttacc tggtcaggct ccacgtattc gatggcgacg ccctgcgggc tggtcttttc
    41221 ggtgattcgc atgggatccc tcggtggccg tagctcgttt gtgggggcaa tcctgcgccc
    41281 gccatgaatt attgtcaaca cccttgcgga aaataatttg cgggggtaat gtgaccccac
    41341 acccacaaca ggaatggccg tggccccgaa gaaaagcaac ctccacaaag aagtccagaa
    41401 ggcgcgcaag cgtagggatt ccgacatcct gcggcgcgcc agcaagggcg aatcgcacga
    41461 agcaatcgct acagcccttg gcatgacccg ccagcgcgtc ggtcagatca tccgcgccag
    41521 caagccgact gtgccggcat gaccaggtgc gcgggctgca acagcagcgc caacgtgctg
    41581 ggccgttggt gcgtctactg cagcaggtat atcaccaggg ttcgccgctg gtgcgctcgc
    41641 caccttggac cgatgccgga aggcggccgc tgcgttgact gcggcgcaaa ggccacgggg
    41701 cgcgaccacc gaaattacgg tcagcgcagc aaggtcgatt tggtttgcca tgggtgcaac
    41761 gccaggcgcg ggccggcagc gatgccgcga catatccagc ggctacaccg ccaacttaac
    41821 aggggagcat gatgacagat tccaacgaaa ggtccgccgc gcaggcagca cgcgacgccg
    41881 gtatccagca ggccgccgaa cacgccgacg acgtgaaccc gaactggggt gatcgcgcgt
    41941 tcgaagtgct gcgcatgttc gccgcggcca agcgcgccag cggcaccagc ttcaccagtg
    42001 aggacgtgcg caacagcatc ctgggcgcgc acctgccgca gccgccgcac ctgcgtgcct
    42061 ggggttcggt gttccagcgc gcggcgaagc aggggatgat cgtcaaaacc ggcgttaccg
    42121 agtcgcgggc agtgcactgc cattgcgcct tcgtggcgac ctggaaggcg gtgtgacatg
    42181 gcaggggatt ggctgaaatt cgaaaaggac acgctggaca agccggaagt gttcgccatc
    42241 gccgaagcgc tggggatcga cccggatgcg gtgatcggca agttgatgag ggtgtggtcc
    42301 tggttcgatt cgcacaccgt ggacggtaac gctgcgcgcg ttacttcatc gttgcttgat
    42361 cgtgtcgctg gcgttcctgg gttcatcgca gcgatggctt tggaaggctg ggcgaccatc
    42421 gaaacgtccg gcgtggcact gcctcacttc gaccgccaca acggcgaaac cgcgaagcag
    42481 cgggcgctga cggcgaaaag ggtgcagaaa cacaaggcaa agggtaacga tgcaggtaac
    42541 gatgccggcg ttagtggcgc gttacctaga gaagagaaga gaagagaaga tgtagaaaag
    42601 caaaaggcca ccggccagca ggctggccac gacgccgcgc cgccggacga attgccgcag
    42661 gacatcgcaa agccggacgc gccggtaccg ccgcaggacg aaggcgaggc gccgccgccg
    42721 aagcggatca ccagcaccgg caagaagcag accgccgaac acttcccgaa gttttgggcc
    42781 gcctacccgg tgaagaaggg caaggccgac gcgctgaaaa agtggaagtc gaagggctgc
    42841 gacgcgatgg ccgatcagat catcgcccac gtgcgccgca tggagcgcga ggacgacgat
    42901 tggctgcgcg gcttcattcc gcacggtagc acctacatca acggcgaacg ctgggaggat
    42961 gaa
//
DBGET integrated database retrieval system