KEGG   Rhodococcus erythropolis PR4: RER_54260
Entry
RER_54260         CDS       T00881                                 
Name
(GenBank) putative oxidoreductase
Organism
rer  Rhodococcus erythropolis PR4
SSDB
Motif
Pfam: Flavin_Reduct
Other DBs
NCBI-ProteinID: BAH36134
NITE: RER_54260
UniProt: C0ZSE2
Position
5875497..5876066
AA seq 189 aa
MEQNQLRGIFGQFASGVTVITCTNADGQPHGATVTAFTAISLEPRLCQITMTRKSKACGY
LGNAPFAVNILAADQVDTAMHFAGRPQRTEPKWIDGPTAPLLDGAAATISCVPWKEYDGG
DHIIFIGEIVDAQSSGKDPLLFYRSTFHDLGATSSTTVWNGSQDDPHSGWFDATTSFTPI
HLQPAPQTI
NT seq 570 nt   +upstreamnt  +downstreamnt
atggaacaaaatcagcttcgaggcatcttcggccaattcgccagcggcgtcaccgtcatc
acctgcaccaacgccgacggtcagccacacggagccaccgtcaccgcattcacggcaatc
tcgctggaaccacgcctgtgccagatcacgatgacgcgaaagtccaaggcgtgcggctac
ctcggcaacgcgccgtttgccgtcaacatccttgccgccgaccaagtggacacggccatg
cattttgccggccgaccgcagcgcaccgaaccgaagtggatcgacggaccgaccgctccc
ctgctcgacggcgccgcagcaactatctcgtgcgtcccgtggaaggagtacgacggtggt
gaccacatcatcttcatcggtgagatcgtcgatgcgcagtcgagtggcaaggatccgctt
ctgttctaccgaagcacttttcacgacctaggcgccacctcgtcgaccacagtctggaac
ggcagtcaggacgacccccacagcggatggttcgacgccaccacttccttcaccccgatt
catcttcagcccgcaccccaaacgatctga

DBGET integrated database retrieval system