KEGG   Rhodococcus erythropolis PR4: RER_54270
Entry
RER_54270         CDS       T00881                                 
Name
(GenBank) putative phenol hydroxylase
  KO
K00483  4-hydroxyphenylacetate 3-monooxygenase [EC:1.14.14.9]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00350  Tyrosine metabolism
rer01100  Metabolic pathways
rer01120  Microbial metabolism in diverse environments
rer01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    RER_54270
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.9  4-hydroxyphenylacetate 3-monooxygenase
     RER_54270
SSDB
Motif
Pfam: HpaB_N HpaB
Other DBs
NCBI-ProteinID: BAH36135
NITE: RER_54270
UniProt: C0ZSE3
Position
5876078..5877706
AA seq 542 aa
MTTTEIPPTGVDPADSGAPQVNPAADSEANRTKNFATRPMTGDEYISSLQDGREIWLHGD
RVKDVTTHPAFRNPIRMTARLYDALHTGEHVDALTVPTDTGNGGVTMPFFRTPTSSADLL
KERDAIATWARMTYGWMGRSPDYKASFLGTLHANKELYAPFQDNAERWYRESQEKVLYWN
HAIINPPVDRQLPPDEVGDVFMKVEKETDAGLIVSGAKVVATGSAITNYNFIAHYGLPIK
KKQFALICTVPMDAPGVKLICRTSYTEHAAVMGSPFDYPLSSRMDENDTIFVFDKVLVPW
ENVFMYGDVDRINAFFPQSGFLPRFTFQGCTRLAVKLDFIAGLLMKALEATGAGGFRGVQ
TRVGEVIGWRNLFWSLTESMARDPEQWVGDSVIPKLEYGLTYRMFMIQGYPRIKEIIEQD
VASGLIYLPSSSLDFKSPEVRPYLDKYVRGSDGITAVDRVKVMKALWDSIGTEFGGRHEL
YERNYSGNHENVKAELLFAAQNRGHASSMKGLAEQCLSEYDLDGWTVPDLIGNDDVSFFK
NR
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgacgaccaccgaaattcctcccaccggcgtcgaccccgcagattccggagcgccacag
gtcaatccggccgccgacagcgaagccaaccgcacgaagaacttcgccacccggccgatg
acgggcgacgagtacatctcgagcctgcaggacggtcgcgagatctggcttcacggtgat
cgcgtgaaggacgtcacgacgcaccccgcgttccggaatccgatccgcatgaccgcaagg
ctgtacgacgctctgcacacgggcgagcacgtggacgccttgaccgttccgacggacacg
ggcaacggcggtgtcaccatgccattcttccgcactccgacgtcgtcggctgatctactc
aaggaacgcgacgccatcgcgacgtgggcacgtatgacctacggctggatgggccgctcc
cccgactacaaggcaagtttcctgggaaccctccacgccaacaaggagttgtacgcaccg
ttccaggacaacgccgagcgctggtaccgcgaatcgcaggagaaggttctgtactggaac
cacgcgatcatcaatcccccggtggatcgccaacttccaccggacgaagtcggcgacgtc
ttcatgaaggtggagaaggaaaccgacgccggtttgatcgtcagcggcgccaaggtggtc
gccaccggatcggcgatcacgaactacaacttcatcgctcactacggtctgccgatcaag
aagaagcagttcgccttgatctgcacggtaccgatggacgctccgggtgtgaagctgatc
tgccgcacctcgtacaccgaacatgctgcggtgatgggcagtccgttcgattacccgctg
tcgagccgcatggacgagaacgacaccatcttcgtcttcgacaaggtgttggttccatgg
gagaacgtcttcatgtacggcgacgtcgaccggatcaacgcattcttccctcaatcgggt
ttcctgccgcgcttcacctttcagggctgcactcgcctggccgtcaagctcgacttcatc
gccggactgttgatgaaagcactcgaagccaccggcgccggcggcttccgcggagttcag
acccgtgtcggcgaggtgatcgggtggcgaaacctcttctggtcgttgaccgaatcgatg
gcacgcgatcccgaacagtgggtcggcgattcggtgatcccgaagctcgagtacggcctc
acctatcgaatgttcatgatccaggggtacccgcggatcaaggagatcatcgaacaggac
gtggcgtcaggcctgatctacctgccttcgagttcactcgacttcaagagcccggaagta
cgcccgtacctcgacaagtacgttcgtggttcggacggcatcaccgccgtcgaccgggtg
aaagtcatgaaggctctgtgggattcgatcggcaccgagttcggcgggcgccacgagctc
tacgagcgcaactactccggcaatcacgagaacgtcaaagcggaactgctgttcgcagcc
cagaatcgtggacacgcaagttccatgaagggactggccgagcagtgcctgagtgaatac
gacctcgacggctggacggtccctgacctcatcggcaacgacgacgtctcgttcttcaag
aaccggtag

DBGET integrated database retrieval system