KEGG   Rhodococcus jostii: RHA1_ro01860
Entry
RHA1_ro01860      CDS       T00382                                 

Name
(GenBank) probable 3-(3-hydroxylphenyl) propionate hydroxylase
  KO
K20944  resorcinol 4-hydroxylase (NADH) [EC:1.14.13.220]
Organism
rha  Rhodococcus jostii
Pathway
rha00362  Benzoate degradation
rha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHA1_ro01860
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.220  resorcinol 4-hydroxylase (NADH)
     RHA1_ro01860
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox_2 NAD_binding_8 DAO FAD_oxidored HI0933_like Pyr_redox NAD_Gly3P_dh_N FAD_binding_2 Thi4 Pyr_redox_3 Lycopene_cycl
Other DBs
NCBI-ProteinID: ABG93671
UniProt: Q0SFL5
Position
complement(1975832..1977424)
AA seq 530 aa
MSAFAQPPGAGRKAVDVAIVGSGPTGMALAALLGCQGRSVVVLERYTGLYNLPRAAAFDD
ETMRTFQKLGVAEKMLPGTNVQRGYVWVNGDDEVLLDIEFDNPGRCGWPAQYMMYQPHLE
SVLDELITSLPTVEIRRGMTVESVDQQDGDDVLVRATDVEGSAYLVRARYVVGCDGGNGV
VRQFAGGELDDYGFFENWLVCDFQLNRDVPDLPTFRQVCDPAEPIAIVNIGPRFHRFSFR
LESAANREEVVHPDKVWPRVATYLTPEDAELVRVANYTFRSCITTQWRHRRILLAGDAAH
QMPPFLAQGMVSGIRDARNLAWKLDMVLAGHPDSLLDTYQAEREPHVRYITEKAIELGRV
QTMRDTALAAQRDAQMIAARKANQKPDKLRYPALSGGLIANHGDMFPQGLVSTSSTTALF
DEIAGTGWLVVADGPQVLSGIAEGDRTAFTEIGGKEVIFGLTSMFDGAPVSDTAGVYTRW
FAAHECVAAIVRPDGYVFGLARDAAELAGLAKELVAAVAPVPSRPPAPTA
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtctgccttcgcacagccgccgggcgcgggaagaaaagcagtcgacgtcgcgatcgtc
ggcagcggccctaccgggatggcactggcggcgctcctggggtgccagggccggagcgtc
gttgtcctcgagaggtacacgggtctgtacaacctgccgcgcgccgccgcgttcgacgac
gagaccatgcgcacattccagaaactcggcgtcgcggagaagatgctgcccggcaccaat
gtccagcgcggctacgtatgggtgaacggcgacgacgaagtgttgctggacatcgagttc
gacaacccgggccgctgcggatggccggcgcagtacatgatgtaccagccccacctcgaa
tccgttctcgacgagctcattacgtccctgccaaccgtcgagatccgccgcgggatgacg
gtcgagtccgtcgaccagcaggacggtgacgacgtgctcgtccgcgccaccgacgtcgag
ggcagcgcgtacctggttcgtgcccgctatgtcgtcggctgcgacggggggaacggcgtc
gtccgccagttcgccggcggcgaactcgacgactacgggttcttcgagaactggctcgtc
tgcgacttccagctcaaccgcgacgtgccggacctccccaccttccgtcaggtctgcgac
cccgccgaaccgatcgccatcgtcaacatcggaccccgcttccaccgattctcgttccgg
ctcgaaagcgcagcgaatcgcgaggaggttgttcacccggacaaggtgtggccacgcgta
gcgacgtatctcaccccggaggatgcggagctcgtccgcgtcgccaactacacgttccgg
tcatgcatcaccacgcagtggcgtcaccgtcggattcttctcgccggcgacgcggcacac
cagatgccgccgttcctggcgcagggcatggtgtcgggaatccgcgacgcacggaacctg
gcctggaagctcgacatggtgctcgccggccaccccgactcgctgctcgacacctaccaa
gccgaacgtgaaccgcacgtccgctacatcaccgagaaggcaatcgaactgggtcgggtc
cagacgatgcgggacaccgcgctcgccgcccagcgcgacgcgcagatgatcgctgcgcgc
aaagccaaccagaagccggacaaattgcgataccccgcgttgtcgggaggcctgatcgcc
aaccacggcgacatgttcccgcagggcctggtgtcgacgtcgagcaccaccgcactcttc
gacgagatcgccggcaccggatggctcgtcgtcgccgacggaccacaggtgttgtccggc
atcgccgaaggcgaccgcaccgcattcaccgaaatcggcggcaaagaggtgattttcggc
ctcacgtcgatgttcgacggagcgcccgtctccgacaccgccggcgtgtacaccagatgg
ttcgccgcccacgagtgcgtcgccgccatcgtgcggcccgacggctacgtcttcggactc
gcacgcgacgccgccgagctcgcaggcctcgccaaggagctcgtcgccgccgtcgctccc
gtgccgtcccggccgccggcgcccacggcctga

DBGET integrated database retrieval system