Rhodococcus sp. B7740: NY08_4583 Help Entry NY08_4583         CDS       T03776                                  Name (GenBank) NTP pyrophosphohydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism rhb  Rhodococcus sp. B7740 Brite KEGG Orthology (KO) [BR:rhb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:rhb03400]     NY08_4583 Enzymes [BR:rhb01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      NY08_4583 DNA repair and recombination proteins [BR:rhb03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     NY08_4583  Prokaryotic type     NY08_4583 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX Nudt16-like Motif Other DBs NCBI-ProteinID:  AJW42583 Position 4675560..4675970 Genome browser AA seq 136 aa AA seqDB search MSGSRIIRTAGLAYVRNRRMIQTRSAGKSAFYMAGGKIDPGETPEQALHREIREELDASV KGARLLGVFECQAWGHPAGTPLELTCFLADLADEPTPTSEIAEIRYFTRDEYAAMPDVAP GSLMVFDRMRALDLID NT seq 411 nt NT seq  +upstreamnt  +downstreamnt gtgagcggatcgaggatcattcggaccgccgggctggcgtacgtccggaatcgccgaatg atccaaacgcgatcggccggcaaatccgcgttctacatggcgggcggaaagatcgacccc ggcgagacacccgagcaagccctccatcgggagatcagagaagagctcgacgcgtcggtc aagggtgcccggctgctcggggtgttcgagtgtcaggcatgggggcacccggcgggcacc ccactcgagctcacgtgtttcctcgccgatctggccgacgagccgacgccgaccagcgag atcgcagagatcagatacttcacccgtgacgagtacgcagcgatgccggacgtcgctccg ggatcactgatggtgttcgaccggatgagagcgctcgatttgatcgactga

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (2) Pfam (2) All databases (4) Download RDF

DBGET integrated database retrieval system