KEGG   Sinorhizobium fredii NGR234: NGR_b11500
Entry
NGR_b11500        CDS       T00888                                 

Name
(GenBank) hypothetical protein
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
rhi  Sinorhizobium fredii NGR234
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhi02000]
    NGR_b11500
Transporters [BR:rhi02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   NGR_b11500
SSDB
Motif
Pfam: LysE TerC
Other DBs
NCBI-ProteinID: ACP22603
UniProt: C3KR95
Position
pNGR234b:complement(1111857..1112474)
AA seq 205 aa
MLFAKGLLLGLAIAAPLGPIGTLCISRTLERGFWAGVAGGLGTALADATYAMMAAAGFAA
FATFLATLSVPLGLVGGVFMLWLGWRGLRPRPVAAPAEIGARDLLHTTTATFLLTMANPA
TILTFAAIFAGLGLAAVGDGASAAIVVAGVFLGSLGWWFLLSGGVTLAKTRLPDGFAAWT
SRLSGLLLIAFGLAALASAAAGLAA
NT seq 618 nt   +upstreamnt  +downstreamnt
ttgctcttcgcaaaaggactgctcctcgggcttgccatcgccgcgccgctcggtccgatc
ggcacgctttgcatcagccgcacgctggaacgcggtttctgggccggcgtcgcaggcggt
ctcgggacggcgcttgccgacgcaacttacgcgatgatggcggcggccggctttgcggcg
tttgcgacatttctcgcgacgctctcggttccgctcggtctcgtcggcggtgtcttcatg
ctttggctcggctggcgcggattgaggccccggccggtcgcggcgccggccgagatcggc
gcgcgcgacctgctgcacacgacgactgcgaccttcctgctgacgatggcgaaccctgcg
accatcctgacgttcgccgcgatcttcgcgggcctcggccttgcggccgtcggcgatggg
gcgagcgcggcgatcgtcgtggccggcgtcttcctcgggtcgctcggctggtggtttctc
ctgagcggcggcgtcacgctcgcgaagaccaggctgcctgacggttttgccgcctggacg
tcgcggctttccggcctgcttctgatcgctttcggccttgccgcccttgcttcggcggct
gccggtctggccgcgtag

DBGET integrated database retrieval system