Rhodococcus sp. M8-33: QWW98_21940 Help Entry QWW98_21940       CDS       T10460                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism rhoq  Rhodococcus sp. M8-33 Pathway rhoq00261   Monobactam biosynthesis rhoq01100   Metabolic pathways rhoq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhoq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QWW98_21940  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rhoq01008]     QWW98_21940 Polyketide biosynthesis proteins [BR:rhoq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QWW98_21940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF7435 DR2241 Motif Other DBs NCBI-ProteinID:  WVN75047 Position 4819985..4820224 Genome browser AA seq 79 aa AA seqDB search MSTNPFDDEDGRFYVLVNDEEQYSLWPTFSEVPQGWRVVFGEESRAACVEYVEKNWTDMR PKSLRDAMEADEKARNAGA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcacgaatccttttgacgacgaagacggccgcttctacgtcctcgtgaacgacgag gagcagtactcgctgtggccgactttctccgaggtgccgcaggggtggcgcgtggtgttc ggggaggagtcgcgtgcagcatgcgtcgagtacgtggagaagaactggaccgacatgcgg ccgaagagcctgcgtgacgccatggaggcagacgagaaggcccgcaacgcgggcgcctga

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (3) Pfam (3) All databases (4) Download RDF

DBGET integrated database retrieval system