KEGG   Rivularia sp. PCC 7116: Riv7116_3968
Entry
Riv7116_3968      CDS       T02364                                 

Name
(GenBank) 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00404  Staurosporine biosynthesis
riv01100  Metabolic pathways
riv01110  Biosynthesis of secondary metabolites
riv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:riv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    Riv7116_3968
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Riv7116_3968
Enzymes [BR:riv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     Riv7116_3968
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase Pyr_redox_2 DAO SE NAD_binding_8 FAD_binding_2 GIDA Pyr_redox FAD_oxidored HI0933_like AlaDh_PNT_C Pyr_redox_3 ApbA 3HCDH_N Thi4
Other DBs
NCBI-ProteinID: AFY56408
UniProt: K9RG15
Position
complement(4947223..4948512)
AA seq 429 aa
MSKIIIVGGGLAGGLAAIYLARRGHSVHVVEKRSDPQENISSYVDRSSSRGIGVSMTARG
IKAVLGAGIPKEELDLCGEPISGMSFFVGGKFKVRKLVPVENLLPLSLDRSAFQKLLNKH
GIINGVKYHFGHKCIDVNLEQKYITTQDKNDDFHYISGDLIIATDGARSKVRQAMQNAIR
CFEFHQSFFRHGYKTLVIPDAAKLNFRKELLYFFGMDSKGLFGGRAAIIPDGSISFCICL
PYKGAISLNMQKKEEVLQFFTRYLPEMPADTRNEMVKQFLEKPSNDLINARSSTFHYKKN
ALLLGDSAHATAPFLGQGMNMALEDAQIFSQLLEKNHDDFEKTLPEFTQLRKIEADAMQD
MARANYQVLSSSSPILPMRIKYTNFMHKKFPTVYPPDMAEKLYFTSMPYSHLQNLQSQQN
VWYKLGRMN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgagtaaaataattattgttggtggaggactcgcaggcggacttgccgctatttattta
gcccgtagagggcattccgtccacgtagtagaaaaacgttcagatccgcaagaaaatatc
tcttcatatgtagatagatcgagttcccgaggaattggtgtcagcatgacagcaagagga
attaaagcagttctcggtgcaggtattcccaaagaagaattagatttgtgcggtgagccg
atatctggcatgtctttttttgtcggaggtaaatttaaagttagaaaattagttccagtt
gaaaatttattgccgctttctttagatagatccgcatttcagaagttactgaataaacac
ggcataatcaatggtgttaaatatcattttgggcataaatgtattgatgttaatctcgaa
caaaaatatataactacccaagataaaaacgatgattttcattatatatctggcgactta
ataattgctacagacggtgctcgttcaaaagttcgtcaggctatgcaaaacgctatccgt
tgctttgaatttcatcagtcattttttagacatggttacaaaactttagtaatacccgat
gccgcgaagctaaactttcgcaaggaattattatatttctttggcatggattcaaaaggc
ttgtttggcggccgtgcggcaatcattccagatggtagcatcagtttttgcatctgcttg
ccttataagggagcaattagtttgaacatgcaaaagaaggaagaagttttgcaatttttt
acgcgctatctccccgagatgccagcagatacccgtaatgaaatggtaaaacagtttctc
gaaaaacccagtaacgatttaattaatgctagatcgagtacgttccattacaaaaaaaat
gcattactactcggcgactctgcccatgcaaccgcgccatttttgggacagggaatgaat
atggcacttgaagatgcccaaatattttctcagctattagaaaaaaatcatgacgatttt
gaaaaaaccctacctgaatttacccagttgagaaaaatagaagctgacgctatgcaagat
atggcacgtgctaattatcaggtattaagttcttccagccctatattgcccatgcgtatt
aaatacacaaattttatgcacaagaaatttcctacagtttacccccccgatatggctgaa
aaactctactttacctcaatgccttacagccatttacagaatctgcaaagccagcaaaat
gtttggtacaaattaggtcgaatgaattag

DBGET integrated database retrieval system