Rubrobacter marinus: GBA65_19800 Help Entry GBA65_19800       CDS       T07670                                  Name (GenBank) NUDIX domain-containing protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism rmar  Rubrobacter marinus Brite KEGG Orthology (KO) [BR:rmar00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:rmar03400]     GBA65_19800 Enzymes [BR:rmar01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      GBA65_19800 DNA repair and recombination proteins [BR:rmar03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     GBA65_19800  Prokaryotic type     GBA65_19800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 DUF4916 Nudt16-like Motif Other DBs NCBI-ProteinID:  QIN80386 UniProt:  A0A6G8Q1P6 Position complement(3912290..3912673) Genome browser AA seq 127 aa AA seqDB search MVDVVVPDGEGRVLLIRRGSEPYEGSWALPGGFVDVGETVGDAAVREAKEETGLDVELSR LVGVYSDPGRDPRGHNVSVAFLARAEGDPSAASDADEAAFLEPSSTELAFDHASIISDAL AAPPPAR NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggtggacgtcgtcgtacccgacggggaggggcgcgtgctcctcataaggcgcggcagc gagccctacgaggggagctgggccctgccgggcggtttcgtggacgtcggagagacggtg ggggacgccgccgtccgcgaggcgaaggaggagacgggcctcgacgtcgagctctcccgc ctcgtcggcgtctactcggaccccgggcgcgacccgcgcggccacaacgtgagcgtcgcc tttctggcccgggccgagggcgacccgtccgcggcctcagacgccgacgaggccgccttc ctggagccgtcgtccacggagctggccttcgaccacgcgagcataatctcggacgccctc gccgctccaccgccagcgcgataa

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (4) Pfam (4) All databases (6) Download RDF

DBGET integrated database retrieval system