KEGG   Ralstonia mannitolilytica: TK49_07985
Entry
TK49_07985        CDS       T03778                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
rmn  Ralstonia mannitolilytica
Pathway
rmn00626  Naphthalene degradation
rmn01100  Metabolic pathways
rmn01120  Microbial metabolism in diverse environments
rmn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rmn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    TK49_07985
Enzymes [BR:rmn01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     TK49_07985
SSDB
Motif
Pfam: DSBA Thioredoxin_5
Other DBs
NCBI-ProteinID: AJW46267
Position
1:1672715..1673308
AA seq 197 aa
MMVDFYFDFLSPFSYLANHRLSVLAGRYGFSIQYHAIDLARAKTAIGNIGPSNRDLKVKL
DYLKVDLQRWADLYRIPLVFPPNFNSRRVNAGLYYPAARERAAEYVRLVFDSAWGKGWAL
DADSLLAEVCDKLNWDLGEFEDFLNSENAAKAYDEETQAAIDRKVFGVPTVFWDDQMWWG
NDRLFMLESRLQKETQP
NT seq 594 nt   +upstreamnt  +downstreamnt
gtgatggtcgatttttatttcgattttttgagcccattttcgtatctggccaaccaccgt
ttgtcggtgctcgccgggcgttatggattctccatccagtatcacgccattgatttggcg
cgagcaaaaacggccattggcaacatcgggccatccaatcgggacctcaaggtcaagctt
gactacttaaaggtggatttgcagcgatgggccgatctctataggattccgttggttttc
ccccctaacttcaacagccgccgggtgaatgccggactgtattacccggcagccagggag
cgagccgctgaatatgttcgccttgttttcgattcggcttgggggaaagggtgggcactg
gatgctgatagcttgctggctgaggtatgcgacaagctaaactgggatctcggtgaattt
gaagattttttgaacagcgaaaatgccgccaaggcatacgacgaagagacgcaggcggcc
attgaccgaaaggttttcggggttcccaccgtgttttgggatgatcaaatgtggtgggga
aatgaccgccttttcatgcttgagagcaggttgcaaaaggaaacgcaaccataa

DBGET integrated database retrieval system