KEGG   Rattus norvegicus (rat): 100359421
Entry
100359421         CDS       T01003                                 

Definition
(RefSeq) histone H3.3A-like
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100359421
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100359421
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100359421
  09165 Substance dependence
   05034 Alcoholism
    100359421
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100359421
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100359421
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100359421
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100359421
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S
Other DBs
NCBI-GeneID: 100359421
NCBI-ProteinID: XP_038934066
RGD: 2323872
Position
6
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQRASIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatccactggtggtaaagcacccaggaaacaa
ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtagcactccgagaaatcagacgctatcagaagtccactgaa
cttctgattcgcaagctcccttttcagcgtctggtgcgagaaattgctcaggacttcaaa
acagacctgcgcttccagagggcatctattggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagataccaacctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagatatccagctagcacgccgcatacgcggagaacgtgcttaa

KEGG   Rattus norvegicus (rat): 100360868
Entry
100360868         CDS       T01003                                 

Gene name
H3f3c
Definition
(RefSeq) histone H3.3A
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100360868 (H3f3c)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100360868 (H3f3c)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100360868 (H3f3c)
  09165 Substance dependence
   05034 Alcoholism
    100360868 (H3f3c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100360868 (H3f3c)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100360868 (H3f3c)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100360868 (H3f3c)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100360868 (H3f3c)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 100360868
NCBI-ProteinID: XP_003750396
RGD: 2321290
Ensembl: ENSRNOG00000032401
UniProt: D3ZK97
Position
7
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKATRKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatccactggtggtaaagcacccaggaaacaa
ctggctacaaaagccactcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtagcactccgagaaatcagacgctatcagaagtccactgaa
cttctgattcgcaagctcccctttcagcgtctggtgcgagaaattgctcaggacttcaaa
acagacctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagataccaacctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagacatccagctagcacgccgcatacgcggagaacgtgcttaa

KEGG   Rattus norvegicus (rat): 100360950
Entry
100360950         CDS       T01003                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100360950
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100360950
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100360950
  09165 Substance dependence
   05034 Alcoholism
    100360950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100360950
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100360950
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100360950
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100360950
SSDB
Motif
Pfam: Histone CENP-T_C CBFD_NFYB_HMF TAF CENP-S PAF TFIID-31kDa Bromo_TP
Other DBs
NCBI-GeneID: 100360950
NCBI-ProteinID: XP_008769995
RGD: 2321110
Position
17
AA seq 218 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCIVLVMSGRG
KGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN
VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 657 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggtggcaaggccccgcgcaagcaa
ctggctaccaaggccgcccgcaagagcgctccagccaccggcggcgttaagaagccccac
cgctaccgtcctggcaccgtggctctgcgcgagatcaggcgctaccaaaagtcgaccgag
ttgctgatccgcaagctcccattccagcgcttggtacgtgaaatcgctcaggacttcaag
actgacctgcgtttccagagctcggcggtcatggccctgcaggaggcctgtgaggcctac
cttgtgggtctgtttgaggacaccaacctatgcattgtcttagtcatgtctggccgaggc
aagggcgggaagggtctgggcaaaggcggcgctaagcgccaccgcaaagtcctgcgcgac
aacatccagggcatcaccaagcccgccatccgccgcctggcccggcggggaggagtgaag
cgcatctccggcctcatctacgaggagacccgcggtgtgctgaaggtgttcctggaaaac
gtgatccgcgacgccgtcacctacacggagcacgccaagcgcaagaccgtcaccgccatg
gacgtggtctacgcgctcaagcgccagggccgtaccctctatggcttcggtggctaa

KEGG   Rattus norvegicus (rat): 100361558
Entry
100361558         CDS       T01003                                 

Gene name
H3f3a
Definition
(RefSeq) histone H3.3A
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100361558 (H3f3a)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100361558 (H3f3a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100361558 (H3f3a)
  09165 Substance dependence
   05034 Alcoholism
    100361558 (H3f3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100361558 (H3f3a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100361558 (H3f3a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100361558 (H3f3a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100361558 (H3f3a)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 100361558
NCBI-ProteinID: XP_002728089
RGD: 2319910
Ensembl: ENSRNOG00000003220
UniProt: P84245 B0BMY8
Position
13
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatccactggtggtaaagcacccaggaaacaa
ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtagcactccgagaaatcagacgctatcagaagtccactgaa
cttctgattcgcaagctcccctttcagcgtctggtgcgagaaattgctcaggacttcaaa
acagacctgcgcttccagagtgcagcgattggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagataccaacctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagacatccagctagcacgccgcatacgcggagaacgtgcttaa

KEGG   Rattus norvegicus (rat): 102548682
Entry
102548682         CDS       T01003                                 

Definition
(RefSeq) uncharacterized protein LOC102548682
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102548682
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102548682
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102548682
  09165 Substance dependence
   05034 Alcoholism
    102548682
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    102548682
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    102548682
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    102548682
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102548682
SSDB
Motif
Pfam: Histone CENP-T_C TAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP PAF Couple_hipA
Other DBs
NCBI-GeneID: 102548682
NCBI-ProteinID: XP_017456208
RGD: 7725170
Ensembl: ENSRNOG00000045646
Position
17
AA seq 342 aa
MNQRLFSEPHTVSNMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKR
ISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRRSPGSVHVSS
FGSEMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ
KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCVLTTM
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV
FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaaccaaaggctcttttcagagccacacacggtttcaaatatgtccggtcgcggcaaa
ggagggaaaggcctgggcaaaggcggcgctaagcgccaccgcaaagtcctgcgcgacaac
atccaggggatcactaagcccgccatccgccgcctggcccggcgcggaggagtgaagcgc
atctccggcctcatctacgaggagacccgcggtgtgctgaaggtgttcctggagaacgta
atccgcgacgccgtcacctacacggagcacgccaagcgcaagaccgtcactgctatggac
gtggtctacgcgcttaaacgccagggccgcaggagccctgggtcagtccatgtttcttct
ttcggtagtgaaatggctcgtactaagcagaccgctcgcaagtccaccggcggcaaagcc
ccgcgcaagcagctcgccaccaaggctgcccgcaagagcgccccggccaccggcggcgtg
aagaagccccaccgctaccgtcccggcaccgttgctctgcgcgagatccggcgctaccag
aagtccaccgagctgctgatccgcaagctgccgttccagcgcctggtgcgcgaaatcgcg
caggacttcaagaccgaccttcgcttccagagctcggcggtcatggcccttcaggaggcc
agcgaggcctaccttgtgggtctgtttgaggacaccaatctgtgcgtactcacaaccatg
tctggacgtggtaaaggtggtaaaggccttgggaaaggtggcgctaagcgtcatcgcaaa
gtcctgcgcgacaatatccagggcatcacaaagcccgccatccgccgcctggcccggcgc
ggaggagtgaagcgcatctccggcctcatctacgaggaaacccgcggtgtgctgaaggtg
ttcctggagaacgtgatccgcgacgccgtcacctacacggagcacgccaagcgcaagacg
gtcactgccatggacgtggtctacgcgcttaaacgccagggccgcacactctacggcttc
ggtggttaa

KEGG   Rattus norvegicus (rat): 102549173
Entry
102549173         CDS       T01003                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC102549173
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102549173
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102549173
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102549173
  09165 Substance dependence
   05034 Alcoholism
    102549173
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    102549173
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    102549173
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    102549173
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102549173
SSDB
Motif
Pfam: Histone PAF CENP-T_C
Other DBs
NCBI-GeneID: 102549173
NCBI-ProteinID: XP_006254041
RGD: 7709329
Ensembl: ENSRNOG00000050478
UniProt: D3ZJ08
Position
17
AA seq 253 aa
MNLWRATFEMLQGQSKCFYVYLRARFFLPSTLVYPFYGMARTKQTARKSTGGKAPRKQLA
TKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD
LRFQSSAVMALQEASEAYLVGLFEDTNLCSIVLLGHQGKGKPLAKAGLSAHRKVLRDNIQ
GITKPAIRRLARCGGVKRISGLIYKETRGMLKVFLENVIRDAVTYLEQANRKTAMDVVYT
LKRQGRTLYGFGG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaatttgtggcgcgcgactttcgaaatgttgcaaggccaatcaaaatgtttctacgtc
tatttaagggcaagattctttcttccttctacattggtttatcctttttacgggatggca
cgtactaagcagaccgctcgaaagtccacgggcggcaaagccccgcgcaagcagctcgcc
accaaggccgcccgcaagagcgctccggccaccggcggcgtgaagaagccccaccgctac
cgtcccggcaccgtggctctgcgcgagatccggcgctaccagaagtccaccgagctgctg
atccgcaagctgccgttccagcgcctggtgcgcgaaatcgcgcaggacttcaagaccgac
cttcgcttccagagctcggcggtcatggcccttcaggaggccagcgaggcctaccttgtg
ggtctgtttgaggacaccaacctgtgcagcatagtcttgttggggcaccaggggaaaggg
aagcccttggcaaaggcggggctaagcgcccaccgcaaagtcttgcgcgacaatatccag
ggcatcaccaagcccgccatccgccgcctggctcggtgcggaggggtgaagcgcatctct
ggcctcatctacaaggagacccgcggtatgctgaaggtgttcctggagaacgtgatccgc
gacgccgtcacctaccttgagcaagccaatcgcaagactgccatggatgtggtctatact
ctcaagcgccagggccgcactctctatggcttcggcggctga

KEGG   Rattus norvegicus (rat): 102551184
Entry
102551184         CDS       T01003                                 

Definition
(RefSeq) uncharacterized protein LOC102551184
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102551184
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102551184
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102551184
  09165 Substance dependence
   05034 Alcoholism
    102551184
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    102551184
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    102551184
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    102551184
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102551184
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S TAF CBFD_NFYB_HMF TFIID-31kDa Bromo_TP PAF PspA_IM30
Other DBs
NCBI-GeneID: 102551184
NCBI-ProteinID: XP_006254044
RGD: 7529415
Position
17
AA seq 333 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRRQPSLVHVRVGKAAMARTKQTARK
STGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR
LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRSYGMSGRGKGGKG
LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtctggacgtggtaaaggcggtaagggcctgggcaaaggcggcgctaagcgtcatcgc
aaagttctgcgcgacaacatccagggcatcactaagcccgccatccgccgcctggcccgg
cgcggaggagtgaagcgcatctccggtctcatctacgaggagacccgcggtgtgctgaag
gtgttcctggagaacgtgatccgcgacgcggtcacctacacggagcacgccaagcgcaag
accgtcactgccatggatgtggtctacgcgctcaaacggcagggccggcggcagccatca
cttgttcatgtaagagttggtaaggctgctatggctcgtactaagcagaccgctcgcaag
tctaccggcggcaaggccccgcgaaagcagctggctactaaggccgctcgtaaaagcgcc
ccggctaccggcggcgtgaagaagccccatcgctaccgtcccggcaccgtggctctgcgc
gagatccggcgctaccagaagtccaccgagctgctgatccgcaagctgccgttccagcgc
ctggtgcgcgagatcgctcaggacttcaagaccgacctgcgcttccagagttcggccgtc
atggccctacaggaagcgagcgaggcctaccttgtgggtctgtttgaggacaccaacctg
tgcgccatccacgccaagcgttcttacggtatgtctggacgcggtaaaggcggtaagggc
ctgggtaaaggcggcgctaagcgccaccggaaagtcctacgagacaacatccagggcatc
actaagcccgctatccgccgcctggcccggcgtggcggagtgaaacgcatctccggcctc
atctacgaggagacccgcggtgtgctgaaggtgtttctggagaacgtgatccgcgacgcc
gtcacctacacggagcacgccaagcgcaagaccgtcaccgccatggatgttgtctacgcg
ctcaagcgccagggccgcactctctacggcttcggcggctaa

KEGG   Rattus norvegicus (rat): 108349691
Entry
108349691         CDS       T01003                                 

Definition
(RefSeq) histone H3.3A-like
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108349691
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108349691
  09163 Immune disease
   05322 Systemic lupus erythematosus
    108349691
  09165 Substance dependence
   05034 Alcoholism
    108349691
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    108349691
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    108349691
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    108349691
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108349691
SSDB
Motif
Pfam: Histone PAF CENP-T_C CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 108349691
NCBI-ProteinID: XP_017445789
RGD: 11381356
Position
1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKASHKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRILGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatccactggtggtaaagcacccaggaaacaa
ctggctacaaaagcctctcacaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtagcactccgagaaatcagacgctatcagaagtccactgaa
cttctgattcgcaagctcccctttcagcgtctggtgcgagaaattgctcaggacttcaaa
acagacctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagataccaacctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagacatccagctagcacgccgcatactcggagaacgtgcttaa

KEGG   Rattus norvegicus (rat): 117056
Entry
117056            CDS       T01003                                 

Gene name
H3f3b
Definition
(RefSeq) histone H3.3
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    117056 (H3f3b)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    117056 (H3f3b)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    117056 (H3f3b)
  09165 Substance dependence
   05034 Alcoholism
    117056 (H3f3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    117056 (H3f3b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    117056 (H3f3b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    117056 (H3f3b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117056 (H3f3b)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 117056
NCBI-ProteinID: NP_446437
RGD: 621095
Ensembl: ENSRNOG00000006532
UniProt: P84245 B0BMY8
Position
10
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgaaccaagcagaccgctaggaagtccaccggagggaaagccccccgcaaacag
ctggccaccaaggcggcccggaaaagcgcgccctctactggcggggtgaagaaacctcat
cgctacaggcccgggaccgtggctctaagagagatccgtcgttaccagaaatcgactgag
ctgctcatccggaagctacccttccagaggttggtgagggagatcgcccaggatttcaaa
accgacttgaggtttcaaagtgcagccatcggtgcccttcaggaggctagcgaggcatac
ctggtggggttgtttgaagataccaatctgtgtgccatccacgccaagagagtcaccatc
atgcccaaagacatccagttggctcgccggatacggggggagagagcttaa

KEGG   Rattus norvegicus (rat): 291159
Entry
291159            CDS       T01003                                 

Gene name
Hist1h2ail1
Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    291159 (Hist1h2ail1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    291159 (Hist1h2ail1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    291159 (Hist1h2ail1)
  09165 Substance dependence
   05034 Alcoholism
    291159 (Hist1h2ail1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    291159 (Hist1h2ail1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    291159 (Hist1h2ail1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    291159 (Hist1h2ail1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   291159 (Hist1h2ail1)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 291159
NCBI-ProteinID: NP_001013074
RGD: 1311554
Ensembl: ENSRNOG00000046434
UniProt: Q6LED0
Position
17
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgtactaagcagaccgctcgcaagtccaccggcggcaaggctccgcgcaagcag
ctggccaccaaggctgcccgtaaaagtgccccggccaccggtggcgtgaagaagccccat
cgctaccgtccgggtaccgtagcgttgcgtgagatccggcgctaccagaagtcgaccgaa
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgctcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcctgtgaggcctac
cttgtgggtctgtttgaggacaccaacctatgcgccatccacgccaagcgtgtgaccatc
atgcccaaggacatccagctggcccgccgcattcgtggcgagagggcttga

KEGG   Rattus norvegicus (rat): 310678
Entry
310678            CDS       T01003                                 

Gene name
Hist2h3c2
Definition
(RefSeq) histone cluster 2 H3 family member C2
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    310678 (Hist2h3c2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    310678 (Hist2h3c2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    310678 (Hist2h3c2)
  09165 Substance dependence
   05034 Alcoholism
    310678 (Hist2h3c2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    310678 (Hist2h3c2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    310678 (Hist2h3c2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    310678 (Hist2h3c2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   310678 (Hist2h3c2)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 310678
NCBI-ProteinID: NP_001101168
RGD: 1306445
Ensembl: ENSRNOG00000060366
UniProt: D3ZJ08
Position
2
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgtacaaagcagaccgcccgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcaccgtggcgctgcgggagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
acggacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac
ctggtgggtctgttcgaggacaccaacctgtgcgccatccacgccaaacgcgtcaccatc
atgcccaaggacatccagttggcccgtcgcatccgcggggagcgcgcctaa

KEGG   Rattus norvegicus (rat): 367254
Entry
367254            CDS       T01003                                 

Gene name
RGD1564447
Definition
(RefSeq) histone H3.3A-like
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    367254 (RGD1564447)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    367254 (RGD1564447)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    367254 (RGD1564447)
  09165 Substance dependence
   05034 Alcoholism
    367254 (RGD1564447)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    367254 (RGD1564447)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    367254 (RGD1564447)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    367254 (RGD1564447)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   367254 (RGD1564447)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-T_C PAF
Other DBs
NCBI-GeneID: 367254
NCBI-ProteinID: XP_346042
RGD: 1564447
Ensembl: ENSRNOG00000032108
UniProt: A0A0G2K5X7
Position
9
AA seq 136 aa
MPHTKQSVRKSTGGKAPRKQLATKAAPKSALSTGGVKKPHRYRPGTGALGETRCYQKFTE
LLICELPFQRLVREIAQDFKTDLRFQSAATDVLQEASEAYLVGHSEDTNLCVIHAKHVTI
MSKDIQLAHHIRGEHA
NT seq 411 nt   +upstreamnt  +downstreamnt
atgcctcatacaaagcagtctgtccgcaaatccaccggtggtaaagcacccaggaaacaa
ctggctacaaaagccgctcccaagagtgcgctctctactggaggggtgaagaaacctcat
cgttacaggcctggtaccggggcactcggtgaaaccagatgctatcagaagttcactgaa
cttctgatttgcgagctcccctttcagcgtctggtgcgagaaattgctcaggacttcaaa
acagacctgcgcttccagagtgcagctactgatgttttgcaggaggcaagtgaggcctat
ctggttggccattctgaagataccaacctgtgtgttatccatgccaaacatgtaacaatt
atgtcaaaagatatccagctagcacaccacatacgtggagaacatgcttaa

KEGG   Rattus norvegicus (rat): 500882
Entry
500882            CDS       T01003                                 

Gene name
RGD1564548
Definition
(RefSeq) histone H3.3A-like
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    500882 (RGD1564548)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    500882 (RGD1564548)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    500882 (RGD1564548)
  09165 Substance dependence
   05034 Alcoholism
    500882 (RGD1564548)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    500882 (RGD1564548)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    500882 (RGD1564548)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    500882 (RGD1564548)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   500882 (RGD1564548)
SSDB
Motif
Pfam: Histone PAF TMA7
Other DBs
NCBI-GeneID: 500882
NCBI-ProteinID: XP_038936142
RGD: 1564548
Ensembl: ENSRNOG00000031680
Position
7
AA seq 136 aa
MARTKQTARKSTSDTAPRKQLATKASCKSAPSTGGVKKPHRYRPGTVALREIRCYQKSTE
LLIRKLPFQRLVREMAQDFKTDLRFQSAAIGALQEASEACLVGLFEDTNLCAVHTKHVTI
RSKNIQLARRIRGERV
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatccaccagtgatacagcacccaggaaacaa
ctggctacaaaagcctcttgcaagagtgcaccttctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtggcactccgtgaaatcagatgctatcagaagtccactgaa
cttctgattcgcaagctcccctttcagcgtttggtacgagaaatggctcaggacttcaaa
acagacctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctgt
ctggttggcctttttgaagataccaacctgtgtgctgtccataccaaacatgtaacaatt
aggtcaaaaaatattcagctagcacgccgcatacgtggggaacgtgtttaa

KEGG   Rattus norvegicus (rat): 679994
Entry
679994            CDS       T01003                                 

Gene name
H3c1
Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    679994 (H3c1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    679994 (H3c1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    679994 (H3c1)
  09165 Substance dependence
   05034 Alcoholism
    679994 (H3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    679994 (H3c1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    679994 (H3c1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    679994 (H3c1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   679994 (H3c1)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 679994
NCBI-ProteinID: XP_017456209
RGD: 1598076
Ensembl: ENSRNOG00000046144
UniProt: Q6LED0
Position
17
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggctccgcgcaagcag
ttggccaccaaagctgcccgcaaaagcgccccggccaccggcggtgtgaagaagccccac
cgctaccgtcccggcaccgtggctctgcgcgagatccggcgctaccagaagtccaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgtgagatcgcgcaggacttcaag
accgacctgcgtttccagagctcggctgtcatggccctgcaggaggcttgtgaggcctac
cttgtgggtctgtttgaggacaccaatctgtgcgccatccacgccaagcgtgtgaccatc
atgcccaaggacatccagctggcccgccgcatccgcggggagagggcgtaa

KEGG   Rattus norvegicus (rat): 680498
Entry
680498            CDS       T01003                                 

Gene name
Hist1h3b
Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    680498 (Hist1h3b)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    680498 (Hist1h3b)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    680498 (Hist1h3b)
  09165 Substance dependence
   05034 Alcoholism
    680498 (Hist1h3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680498 (Hist1h3b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    680498 (Hist1h3b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    680498 (Hist1h3b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   680498 (Hist1h3b)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF Daxx
Other DBs
NCBI-GeneID: 680498
NCBI-ProteinID: XP_001057443
RGD: 1591702
Position
17
AA seq 189 aa
MFSLSFLDLNAHQSPVWNMTSSTYRPIQEGGLLYIYLNFLCTHLILHSSQRSQMARTKQT
ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP
FQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL
ARRIRGERA
NT seq 570 nt   +upstreamnt  +downstreamnt
atgttttccctttcattccttgatttaaacgcgcaccaatcccctgtttggaacatgaca
tcatcaacttaccgtccaatccaagaaggtggcttgttatatatatacttgaattttctc
tgcacacacctcattctacattcctctcaacgttctcaaatggcccgtactaagcagacc
gctcgcaagtccaccggtggcaaagccccgcggaagcagctggccaccaaagctgcccgc
aagagcgctccggctaccggcggcgtgaagaagccccaccgctaccgtcctggcaccgtg
gctctgcgcgagatccggcgctaccagaagtcgacagagctgctgatccgcaagctgcct
ttccagcgcctggtgcgcgagatcgcgcaggacttcaagaccgacttgcgcttccagagc
tcggcggtcatggccctgcaggaggcctgtgaggcctaccttgtgggtctatttgaggac
accaacctgtgcgccatccacgccaagcgtgtgaccatcatgcccaaggacatccagctt
gcccggcgcatccggggtgagagggcgtag

KEGG   Rattus norvegicus (rat): 684762
Entry
684762            CDS       T01003                                 

Gene name
H3c13
Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    684762 (H3c13)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    684762 (H3c13)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    684762 (H3c13)
  09165 Substance dependence
   05034 Alcoholism
    684762 (H3c13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    684762 (H3c13)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    684762 (H3c13)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    684762 (H3c13)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   684762 (H3c13)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 684762
NCBI-ProteinID: XP_038952070
RGD: 1586732
Ensembl: ENSRNOG00000061185
Position
17
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagactgctcggaagtccaccggcggcaaggctccgcgcaagcag
ctggccactaaagccgcccgcaagagcgctccggccaccggaggcgtgaagaagccccac
cgctaccgtcccggcaccgtggctctgcgcgagatccggcgctatcagaagtccaccgag
ctgcttatccgcaagctgccattccagcgcctggtgcgcgagatcgctcaggacttcaag
accgaccttcgcttccagagctcggcggtcatggctctgcaggaagcgagcgaggcctac
cttgtgggtctgtttgaggacaccaacctatgcgccatccacgccaagcgtgtgaccatc
atgcccaaggacatccagctggcccgccgcattcgaggggagagggcgtaa

KEGG   Rattus norvegicus (rat): 691496
Entry
691496            CDS       T01003                                 

Gene name
H3f4
Definition
(RefSeq) H3.4 histone
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    691496 (H3f4)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    691496 (H3f4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    691496 (H3f4)
  09165 Substance dependence
   05034 Alcoholism
    691496 (H3f4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    691496 (H3f4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    691496 (H3f4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    691496 (H3f4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   691496 (H3f4)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 691496
NCBI-ProteinID: NP_001103112
RGD: 1583877
Position
10
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYHPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcacgcaccaagcagacagcacggaagtcgacgggaggcaaggctccacgcaagcag
ctagccacgaaggtggcacgcaagagcgctccagccaccggcggcgtgaagaagccgcac
cgctaccaccctggtactgtggcattgcgagagatccggcgctaccagaaatccaccgag
ctgttgatccgcaagctaccgttccagcgcttggtccgtgaaatcgcccaggacttcaag
accgacttgcgcttccagagctcggctgtaatggcgctgcaggaggcctgcgagtcgtac
ctcgtggggctcttcgaggacacgaacctgtgcgctatccatgccaagcgggttaccatc
atgcccaaagacatccagttggctcggcgcatacgcggagaacgggcttag

DBGET integrated database retrieval system