KEGG   Rattus norvegicus (rat): 100359692
Entry
100359692         CDS       T01003                                 

Symbol
H2bc9
Name
(RefSeq) histone H2B type 1-C/E/F/G/I
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100359692 (H2bc9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100359692 (H2bc9)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100359692 (H2bc9)
  09165 Substance dependence
   05034 Alcoholism
    100359692 (H2bc9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100359692 (H2bc9)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100359692 (H2bc9)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100359692 (H2bc9)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100359692 (H2bc9)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF6246 CENP-T_C
Other DBs
NCBI-GeneID: 100359692
NCBI-ProteinID: XP_006254182
RGD: 2325039
Ensembl: ENSRNOG00000058187
UniProt: D3ZLY9
Position
17
AA seq 147 aa
MPEPAKSVPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSKLLQQHRNKSLCLSHRLPGHVI
NT seq 444 nt   +upstreamnt  +downstreamnt
atgccggagcctgccaagtctgttcccgccccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgcttaagcaagtgcacccggacacgggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggaggtccagacggctgtgcgc
ctgctgcttcccggggagctggccaagcacgcggtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagcttctgcagcaacacaggaataagagtctctgtctcagtcat
cgtcttcctggtcacgtaatctaa

KEGG   Rattus norvegicus (rat): 100364835
Entry
100364835         CDS       T01003                                 

Name
(RefSeq) histone H2B type 1-C/E/F/G/I
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100364835
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100364835
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100364835
  09165 Substance dependence
   05034 Alcoholism
    100364835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100364835
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100364835
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100364835
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100364835
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 100364835
NCBI-ProteinID: XP_008769907
RGD: 2320230
Position
17
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagcccgccaagtccgctcccgccccgaagaagggctccaagaaggccgttacc
aaggcccagaagaaagacggcaagaagcgcaagcgcagccgcaaggagagctattccgtg
tacgtgtacaaggtgctgaagcaagtgcacccggataccggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgaacgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgcggtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

KEGG   Rattus norvegicus (rat): 100365043
Entry
100365043         CDS       T01003                                 

Name
(RefSeq) histone H2B type 1-C/E/F/G/I
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100365043
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100365043
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100365043
  09165 Substance dependence
   05034 Alcoholism
    100365043
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100365043
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100365043
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100365043
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100365043
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 100365043
NCBI-ProteinID: XP_038952072
RGD: 2319827
Position
17
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagcctgccaagtccgcccccgccccgaagaagggctccaagaaggccgttacc
aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtgcacccggataccggaatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggagaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgcggtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

KEGG   Rattus norvegicus (rat): 100910200
Entry
100910200         CDS       T01003                                 

Name
(RefSeq) histone H2B type 1-C/E/F/G/I
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100910200
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100910200
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100910200
  09165 Substance dependence
   05034 Alcoholism
    100910200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100910200
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100910200
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100910200
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100910200
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 100910200
NCBI-ProteinID: XP_008769994
RGD: 6499934
UniProt: G3V8B3
Position
17
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagcccgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtgcacccggacacgggcatctcttctaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgt
ctagcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgctgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

KEGG   Rattus norvegicus (rat): 100912338
Entry
100912338         CDS       T01003                                 

Name
(RefSeq) histone H2B type 2-F
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100912338
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100912338
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100912338
  09165 Substance dependence
   05034 Alcoholism
    100912338
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100912338
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100912338
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100912338
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100912338
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 CENP-T_C
Other DBs
NCBI-GeneID: 100912338
NCBI-ProteinID: XP_038959724
RGD: 6487821
Position
2
AA seq 126 aa
MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccggatccagccaagtctgctcctgctccaaagaagggctcgaagaaagctgtcacg
aaagtccagaagaaagatggcaagaagcgcaagcgcagccgtaaggaaagctactctgtc
tacgtgtacaaggtgctgaagcaagtgcacccggacaccggcatctcatctaaggccatg
ggtatcatgaattccttcgtgaacgacatcttcgagcgcatcgcaggtgaggcctcccgt
ctggcgcattacaacaagcgctcgaccatcacttcccgggagatacagacggccgtgcgt
ctgctgcttcccggggagttggctaaacatgctgtgtcggagggcaccaaggctgtgacc
aagtacaccagctccaagtga

KEGG   Rattus norvegicus (rat): 102549061
Entry
102549061         CDS       T01003                                 

Name
(RefSeq) histone H2B type 1-B
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102549061
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102549061
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102549061
  09165 Substance dependence
   05034 Alcoholism
    102549061
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    102549061
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    102549061
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    102549061
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102549061
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 102549061
NCBI-ProteinID: XP_006254040
RGD: 7729692
Ensembl: ENSRNOG00000059949
UniProt: A0A0G2JXE0
Position
17
AA seq 126 aa
MPEPSKSAPAPKKGSKKAISKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagccttcgaaatctgcaccagctcctaagaagggctctaagaaagctatctct
aaagctcagaaaaaggatggcaagaagcgcaagcgtagccgcaaggagagctattccgtg
tacgtgtacaaggtgctgaagcaagtgcacccggacaccggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagaccgccgtgcgc
ctgctgctgccgggggagctggccaagcacgcggtgtcggaaggcaccaaggcggtcacc
aagtacaccagctccaagtga

KEGG   Rattus norvegicus (rat): 103690887
Entry
103690887         CDS       T01003                                 

Name
(RefSeq) histone H2B-like
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103690887
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103690887
  09163 Immune disease
   05322 Systemic lupus erythematosus
    103690887
  09165 Substance dependence
   05034 Alcoholism
    103690887
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    103690887
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    103690887
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    103690887
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103690887
SSDB
Motif
Pfam: Histone SR-25 Connexin DNApol_Exo DUF3405 TFIID_20kDa
Other DBs
NCBI-GeneID: 103690887
NCBI-ProteinID: XP_038956087
RGD: 9462175
Position
X
AA seq 168 aa
MPSAMASTSAVAVVEELSSDTSEELMQIRRSKKAKSKREKDRSKKEKPEDKKPKKEKPDL
FQHQHIDEDEHRAALLIRCRKTSFLKVLKDIHVGFSLSKQSISILDSFVKDMFERIASEA
NFLARQTRSSTIDFREIQTAVHLLLPGELCQRAVAEGTMAMVPYISSK
NT seq 507 nt   +upstreamnt  +downstreamnt
atgccatcagccatggcgtctacctcggctgttgcagttgtggaagagctatcttctgat
acttctgaagaactgatgcaaataagaaggtctaagaaagccaagtccaaaagggaaaag
gacaggtcaaagaaggagaagccagaggataagaagcccaagaaagagaagccagacctt
ttccagcaccaacacattgatgaggatgagcatagagctgcccttctcatcagatgccga
aagaccagctttctgaaggtgctgaaggacatccatgtgggtttctccctctcgaagcag
tccatcagcatcctggattcattcgtgaaggatatgtttgaaagaattgcctccgaagca
aacttcttggcccgtcaaaccagaagctcgactatcgacttcagagagatccagaccgct
gtccatcttctgcttcctggagagctctgccagcgagcagtggctgaaggcaccatggca
atggtcccgtacatctccagcaagtga

KEGG   Rattus norvegicus (rat): 24829
Entry
24829             CDS       T01003                                 

Symbol
H2bc1
Name
(RefSeq) histone H2B type 1-A
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    24829 (H2bc1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    24829 (H2bc1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    24829 (H2bc1)
  09165 Substance dependence
   05034 Alcoholism
    24829 (H2bc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    24829 (H2bc1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24829 (H2bc1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    24829 (H2bc1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24829 (H2bc1)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa CvfB_WH
Other DBs
NCBI-GeneID: 24829
NCBI-ProteinID: NP_072169
RGD: 3855
Ensembl: ENSRNOG00000016865
UniProt: Q00729
Position
17
AA seq 127 aa
MPEVSAKGTTISKKGFKKAVTKTQKKEGRKRKRCREESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt   +upstreamnt  +downstreamnt
atgccggaggtgtcggcaaaggggactactatttccaagaaagggttcaagaaagcagtc
accaagacccagaagaaggagggccggaaacgtaagagatgccgcgaagagagttactcc
atctacatttataaggtgctgaagcaagtgcacccggacaccggcatctcttccaaggcc
atgagcatcatgaactccttcgtgacagacatcttcgagcgcatcgcgggcgaggcatcg
cgcctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggctgtc
cgcctgctgctgcccggggagctggccaagcacgctgtgtccgagggcaccaaggcggtc
accaagtacaccagctccaagtga

KEGG   Rattus norvegicus (rat): 291157
Entry
291157            CDS       T01003                                 

Symbol
Hist1h2bo
Name
(RefSeq) histone cluster 1 H2B family member o
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    291157 (Hist1h2bo)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    291157 (Hist1h2bo)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    291157 (Hist1h2bo)
  09165 Substance dependence
   05034 Alcoholism
    291157 (Hist1h2bo)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    291157 (Hist1h2bo)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    291157 (Hist1h2bo)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    291157 (Hist1h2bo)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   291157 (Hist1h2bo)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF6246
Other DBs
NCBI-GeneID: 291157
NCBI-ProteinID: NP_001099584
RGD: 1311828
Ensembl: ENSRNOG00000054296
UniProt: D3ZNH4
Position
17
AA seq 138 aa
MPDPVKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSKILWNKFYYLPSF
NT seq 417 nt   +upstreamnt  +downstreamnt
atgcctgatccggttaagtccgcccccgccccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaagagagctactcggtg
tacgtgtacaaggtactgaagcaagtgcacccggacaccggcatctcttccaaggccatg
ggcataatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgctgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaaaatcctgtggaacaaattctattatcttccttccttttaa

KEGG   Rattus norvegicus (rat): 295274
Entry
295274            CDS       T01003                                 

Symbol
Hist2h2be
Name
(RefSeq) histone H2B type 2-E
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    295274 (Hist2h2be)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    295274 (Hist2h2be)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    295274 (Hist2h2be)
  09165 Substance dependence
   05034 Alcoholism
    295274 (Hist2h2be)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    295274 (Hist2h2be)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    295274 (Hist2h2be)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    295274 (Hist2h2be)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   295274 (Hist2h2be)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-T_C DUF3915
Other DBs
NCBI-GeneID: 295274
NCBI-ProteinID: XP_227459
RGD: 1562346
Ensembl: ENSRNOG00000045753
UniProt: D4A817
Position
2
AA seq 126 aa
MPELAKSAPAPKKGSKKAVTKGQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIANEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgaactggccaaatccgctccggctcccaagaagggctcaaagaaggctgtcacc
aaggggcaaaagaaagacggcaagaagcgcaagcgcagtcgcaaggagagctactccatc
tatgtgtacaaggtgctgaagcaggtgcatccggacacgggcatctcgtccaaggccatg
ggcatcatgaactcgtttgtcaatgacatcttcgagcgcatcgcaaacgaggcttctcgc
ctggcgcattacaacaagcggtctacaatcacatcgcgggagatccagacggcggtgcgt
ctcctactgcccggagaactggctaagcacgctgtgtcggagggcaccaaggcggtcacc
aagtacacaagcgccaagtag

KEGG   Rattus norvegicus (rat): 303175
Entry
303175            CDS       T01003                                 

Symbol
Hist3h2ba
Name
(RefSeq) histone cluster 3, H2ba
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    303175 (Hist3h2ba)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    303175 (Hist3h2ba)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    303175 (Hist3h2ba)
  09165 Substance dependence
   05034 Alcoholism
    303175 (Hist3h2ba)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    303175 (Hist3h2ba)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    303175 (Hist3h2ba)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    303175 (Hist3h2ba)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   303175 (Hist3h2ba)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa CENP-T_C
Other DBs
NCBI-GeneID: 303175
NCBI-ProteinID: NP_001104597
RGD: 1307520
Ensembl: ENSRNOG00000043419
UniProt: D3ZNZ9
Position
10
AA seq 126 aa
MPEPSRSTPAPKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccggaaccttcccgctccactcccgcgccgaagaagggttccaagaaagccatcacc
aaggcacagaaaaaggatggcaagaaacgcaaacggggccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtgcacccggacaccggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccagcgaggcctcccgc
ctggctcattacaacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgc
ctgctgctgcctggggagctggccaagcatgccgtgtcggaaggcaccaaggcagtcacc
aagtacaccagttccaagtga

KEGG   Rattus norvegicus (rat): 306945
Entry
306945            CDS       T01003                                 

Symbol
Hist1h2bq
Name
(RefSeq) histone cluster 1 H2B family member Q
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    306945 (Hist1h2bq)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    306945 (Hist1h2bq)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    306945 (Hist1h2bq)
  09165 Substance dependence
   05034 Alcoholism
    306945 (Hist1h2bq)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    306945 (Hist1h2bq)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    306945 (Hist1h2bq)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    306945 (Hist1h2bq)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   306945 (Hist1h2bq)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 306945
NCBI-ProteinID: NP_001100822
RGD: 1305011
Ensembl: ENSRNOG00000021198
UniProt: G3V8B3
Position
17
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagcctgcgaaatctgctcccgccccgaagaagggctccaagaaggcagtcacc
aaggcgcagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctactctgtg
tacgtgtacaaggtgctgaagcaagtgcacccggacacaggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ttggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacagccgtgcgc
ctgctactgcccggtgaattggccaagcacgccgtttccgagggcaccaaggcggtcacc
aagtacaccagctccaagtaa

KEGG   Rattus norvegicus (rat): 306969
Entry
306969            CDS       T01003                                 

Symbol
Hist1h2bl
Name
(RefSeq) histone H2B type 1-C/E/F/G/I
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    306969 (Hist1h2bl)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    306969 (Hist1h2bl)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    306969 (Hist1h2bl)
  09165 Substance dependence
   05034 Alcoholism
    306969 (Hist1h2bl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    306969 (Hist1h2bl)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    306969 (Hist1h2bl)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    306969 (Hist1h2bl)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   306969 (Hist1h2bl)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 306969
NCBI-ProteinID: XP_225384
RGD: 1308088
Ensembl: ENSRNOG00000053845
UniProt: M0R4L7
Position
17
AA seq 126 aa
MPETAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgaaactgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtaacc
aaggcgcagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgcttaagcaagtgcatccggacacgggcatctcttccaaggccatg
ggcataatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggctcattacaacaagcgctcgaccatcacgtcccgggagatccagacggcggtgcgt
ctgttgcttcccggggagttggccaagcacgctgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

KEGG   Rattus norvegicus (rat): 361247
Entry
361247            CDS       T01003                                 

Symbol
Hist1h2bd
Name
(RefSeq) histone cluster 1 H2B family member D
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    361247 (Hist1h2bd)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    361247 (Hist1h2bd)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    361247 (Hist1h2bd)
  09165 Substance dependence
   05034 Alcoholism
    361247 (Hist1h2bd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    361247 (Hist1h2bd)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    361247 (Hist1h2bd)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    361247 (Hist1h2bd)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   361247 (Hist1h2bd)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF6246 CENP-T_C
Other DBs
NCBI-GeneID: 361247
NCBI-ProteinID: NP_001101884
RGD: 1307126
Ensembl: ENSRNOG00000060769
UniProt: D3ZWM5
Position
17
AA seq 126 aa
MPEPTKSVPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagcctacgaagtccgtccccgccccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtgcacccggacaccggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggctcattacaacaagcgctccactatcacgtcccgggagatccagacggcggtgcgt
ctgttgctgccgggggagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

KEGG   Rattus norvegicus (rat): 64647
Entry
64647             CDS       T01003                                 

Symbol
Hist1h2bg
Name
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    64647 (Hist1h2bg)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    64647 (Hist1h2bg)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    64647 (Hist1h2bg)
  09165 Substance dependence
   05034 Alcoholism
    64647 (Hist1h2bg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    64647 (Hist1h2bg)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64647 (Hist1h2bg)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    64647 (Hist1h2bg)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64647 (Hist1h2bg)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF DUF6246
Other DBs
NCBI-GeneID: 64647
NCBI-ProteinID: NP_072173
RGD: 621439
UniProt: Q00715
Position
17
AA seq 125 aa
MPEPAKSRPAPKKGSKKAVTKAQKKDGKERKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGERRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTK
YTSSK
NT seq 378 nt   +upstreamnt  +downstreamnt
atgcctgagcccgccaagtcccgtcccgccccgaagaagggctccaagaaggctgtgacc
aaggcccagaagaaggacggcaaggaacgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtgcacccggataccggaatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggagagcgtcgcctg
gcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgcctg
ctgctgcccggggagctggccaagcacgcggtgtccgagggcaccaaggcagtcaccaag
tacaccagctccaagtga

KEGG   Rattus norvegicus (rat): 680312
Entry
680312            CDS       T01003                                 

Symbol
H2bc12
Name
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    680312 (H2bc12)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    680312 (H2bc12)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    680312 (H2bc12)
  09165 Substance dependence
   05034 Alcoholism
    680312 (H2bc12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680312 (H2bc12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    680312 (H2bc12)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    680312 (H2bc12)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   680312 (H2bc12)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 680312
NCBI-ProteinID: NP_001102870
RGD: 1593016
Ensembl: ENSRNOG00000055512
UniProt: G3V9C7
Position
17
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgaacctgccaagtccgcccccgcaccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgtaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtacacccggacacgggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatctttgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcactacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgttgcttcctggggagctggccaagcacgcggtgtccgagggcaccaaggccgtcacc
aaatacaccagcgctaagtaa

KEGG   Rattus norvegicus (rat): 680403
Entry
680403            CDS       T01003                                 

Symbol
Hist1h2bc
Name
(RefSeq) histone H2B type 1-C/E/F/G/I
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    680403 (Hist1h2bc)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    680403 (Hist1h2bc)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    680403 (Hist1h2bc)
  09165 Substance dependence
   05034 Alcoholism
    680403 (Hist1h2bc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680403 (Hist1h2bc)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    680403 (Hist1h2bc)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    680403 (Hist1h2bc)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   680403 (Hist1h2bc)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF6246
Other DBs
NCBI-GeneID: 680403
NCBI-ProteinID: XP_038952337
RGD: 1591796
Ensembl: ENSRNOG00000059382
Position
17
AA seq 134 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSNSSRQSFSV
NT seq 405 nt   +upstreamnt  +downstreamnt
atgcctgagcctgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaaaaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtacacccggacacgggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgcttcccggggagttggccaagcacgcggtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaattcttcaagacaaagtttctctgtgtag

KEGG   Rattus norvegicus (rat): 684444
Entry
684444            CDS       T01003                                 

Name
(RefSeq) histone H2B subacrosomal variant
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    684444
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    684444
  09163 Immune disease
   05322 Systemic lupus erythematosus
    684444
  09165 Substance dependence
   05034 Alcoholism
    684444
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    684444
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    684444
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    684444
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   684444
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TAF Peroxin-3 TFIID_20kDa
Other DBs
NCBI-GeneID: 684444
NCBI-ProteinID: XP_003749220
RGD: 1590323
Ensembl: ENSRNOG00000045818
UniProt: M0R7V6
Position
2
AA seq 123 aa
MAKPILKRYRYIKGHLRPLYRKHLRCSSIHFGHGNYSLYINRVLKEVVPKRGISSHTVDI
MNLMINDIFERIATEACQRMNLRKRCTLTSEDIQKAVYMLMPKKLAKLAVTFGSKAVHRF
IHS
NT seq 372 nt   +upstreamnt  +downstreamnt
atggccaagcccatcctcaaaagataccgctacatcaaaggacatctaagaccattgtat
agaaagcatttacggtgctctagcatccattttggccatggaaattactccctttacata
aacagagtcctgaaggaagttgtccccaagagaggtatatcatctcatactgtggacatc
atgaacctcatgatcaatgacatcttcgaacgcattgctacggaagcctgccagaggatg
aacctcagaaagcgctgtaccctcacctcagaagatatccagaaggcagtgtatatgttg
atgccgaagaagctggctaaacttgctgtgactttcggaagtaaagcagtccacagattc
atccattcctaa

KEGG   Rattus norvegicus (rat): 684797
Entry
684797            CDS       T01003                                 

Name
(RefSeq) histone H2B type 1-C/E/F/G/I
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    684797
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    684797
  09163 Immune disease
   05322 Systemic lupus erythematosus
    684797
  09165 Substance dependence
   05034 Alcoholism
    684797
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    684797
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    684797
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    684797
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   684797
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 684797
NCBI-ProteinID: XP_008769902
RGD: 1586699
Position
17
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagcctgcgaaatccgctcccgccccgaagaagggctccaagaaggccgttacc
aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagttattctgtc
tacgtgtacaaggttctgaagcaagtgcacccggacaccggtatctcttccaaggccatg
ggcatcatgaactcattcgtgaacgacatcttcgaacgcatcgcgggcgaggcgtcgcgt
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgcggtgtccgagggcaccaaggccgtcacc
aaatacaccagctccaagtga

KEGG   Rattus norvegicus (rat): 691488
Entry
691488            CDS       T01003                                 

Symbol
H2bu1
Name
(RefSeq) H2B.U histone 1
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    691488 (H2bu1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    691488 (H2bu1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    691488 (H2bu1)
  09165 Substance dependence
   05034 Alcoholism
    691488 (H2bu1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    691488 (H2bu1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    691488 (H2bu1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    691488 (H2bu1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   691488 (H2bu1)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa CENP-T_C
Other DBs
NCBI-GeneID: 691488
NCBI-ProteinID: NP_001103111
RGD: 1583885
Ensembl: ENSRNOG00000031790
UniProt: M0RBQ5
Position
10
AA seq 126 aa
MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccggatccatccaaatcggctccagcccccaaaaaagggtccaaaaaggcggtcacc
aaggcgcaaaaaaaggatggcaagaaacgcaaacggggccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtgcacccggacaccggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccagcgaggcctcccgc
ctggctcattacaacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgc
ctgctgctgcctggggagctggccaagcatgccgtgtcggaaggcaccaaggcagtcacc
aagtacaccagttccaagtga

DBGET integrated database retrieval system