KEGG   Rattus norvegicus (rat): 100360342
Entry
100360342         CDS       T01003                                 

Gene name
Msh6
Definition
(RefSeq) DNA mismatch repair protein Msh6 isoform X2
  KO
K08737  DNA mismatch repair protein MSH6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno03430  Mismatch repair
rno05200  Pathways in cancer
rno05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100360342 (Msh6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100360342 (Msh6)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100360342 (Msh6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100360342 (Msh6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    100360342 (Msh6)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     100360342 (Msh6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I PWWP MutS_IV MutS_II
Other DBs
NCBI-GeneID: 100360342
NCBI-ProteinID: XP_006239797
RGD: 2322311
Ensembl: ENSRNOG00000016134
UniProt: D4A0U9
Position
6
AA seq 1362 aa
MSRQSTLYSFFPKSPALGDTKEAAARASRKGAAASGASASRGRDAAWSEAGPGSRPAALS
TSLPEAKDLNGGLRRSAAPAVPASSSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIR
KNGKSARVHVQFFDDSPTRGWVSKRMLKPYTGSKSKEAQKGGHFYSSKSEILRAMQRADE
ALSKDKAQRLELAVCDEPSEPEEEEEEEEEETQVHGAYLSDKSEEENQDESEEETQPNAQ
GPRRSSRQVKKRRVISDSESDIGGSDVEFKPDSKQEGSSDEVSSGVGDSDSEGLGSFGKG
APKRKRTVAAHGGLKRKSLKKETGSAKQATRILSETKSTLSAFCAPQNSESQTHVCGGGN
DSSGPTIWYHETLEWLKPEKRRDENRRRPDHPDYNSSTLYVPEDFLNSCTPGMRRWWQFK
SQNFDLVIFYKVGKFYELYHMDAVIGVSELGLIFMKGNWAHSGFPEIAFGRFSDSLVQKG
YKVARVEQTETPEMMEARCRKMAHVSKFDRVVRREICRIITKGTQTYSVLDGDPSENYSR
YLLSLKEKEEDSSGHMRAYGVCFVDTSLGKFFLGQFSDDRHCSRLRTLVAHYPPVQILFE
KGNLSTETKTVLKGSLSSCLQEGLIPGSQFWDATKTLRTLLEGGYFTGNEGSGAELPPVL
KAMTSESDSVGLTPGEESELSLSALGGCVFYLKKCLIDQELLSMANFEEYFPLDSDMVGT
VKPGAVFTKASQRMVLDAVTLSNLEIFLNGTNGSTEGTLLERLDTCHTPFGKRLLKQWLC
APLCSPSAISDRLDAIEDLMAVPDKVAEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPD
TRAIMYEETTYSKKKIIDFLSALEGFKVMCKITRLMEDVADGFKSKTLKQVVTLQTKSPK
GRFPDLTAELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQR
SRIGCRNIVYWGIGRNRYQLEIPENFATRNLPEEYELKSTKKGCKRYWTKVIEKKLSNLI
NAEERRDASLKDCMRRLFYNFDKNHKDWQSAVECTAVLDVLLCLASYSQGGDGPMCRPVL
LLPGEDTHPFLELKGSRHPCITKTFFGDDFIPNDILIGCEEDAEADGKAYCVLVTGPNMG
GKSTLIRQAGLLAVMAQMGCYVPAELCRLTPVDRVFTRLGASDRIMSGESTFFVELSETA
SILRHATAHSLVLVDELGRGTATFDGTAIASAVVKELAETIKCRTLFSTHYHSLVEDYSK
NVCVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHR
KAREFERMNQALQLFREVCLASERPTVNSEAIHRLLALVNQL
NT seq 4089 nt   +upstreamnt  +downstreamnt
atgtcgcgacaaagcaccctatacagcttcttccccaagtccccggcgctcggcgacacc
aaggaggccgcggcccgggcctcacgcaaaggtgccgccgcctccggagcctccgcttcc
cggggccgggatgcggcctggagcgaggctggacctgggtcccggcccgcagcgttatcc
acctcgttgccggaggcaaaggaccttaacggagggctgcggaggtcggccgcgcccgcg
gtccccgccagtagttcttgtgacttctccccaggtgatctggtttgggctaagatggaa
ggttatccttggtggccttgcctggtttacaatcatccctttgatgggacattcatccgc
aagaacgggaaatcagcccgtgttcacgtacagttttttgatgacagtccaacaaggggc
tgggttagcaaaaggatgttaaaaccatatacaggttcaaagtcaaaggaagcccaaaag
ggaggtcatttctacagctcaaagtccgaaatactcagagcaatgcagcgtgcagacgaa
gccttaagtaaagacaaggctcagaggcttgagctggcagtctgtgatgagccttcagag
ccggaggaggaggaggaggaggaggaggaggagacacaggtgcatggggcctatttatct
gataagagtgaagaggaaaatcaggacgagagtgaagaagaaacacagccaaacgctcag
gggcctaggcgaagtagccggcaagtcaaaaagcgaagggtcatctcagactctgagagc
gacattggcggctctgatgtagaattcaagccagacagtaagcaagaaggcagcagtgac
gaagtgagcagtggggttggagacagcgatagcgaaggcctgggcagctttggcaaaggc
gctccaaagcggaagagaacagtggcagctcatggtggacttaaaaggaaaagtctgaag
aaggaaacaggctcagccaaacaagcaactcgcattctgtcagaaaccaagagtaccttg
agtgctttctgtgccccgcagaattctgagtcccaaacccatgtctgtggaggaggtaac
gacagcagtggacccactatctggtatcatgagactttagaatggcttaagccagagaag
agaagagatgagaacaggagacggccagatcacccagactacaactcctccacactgtat
gtgcctgaagacttcctcaactcttgcaccccggggatgaggcggtggtggcagttcaag
tctcagaactttgaccttgtcatcttctacaaagtgggcaagttttatgagttgtatcac
atggacgctgtcattggtgtcagtgagctgggactgatattcatgaagggcaactgggcc
cactctggttttccagagatcgcatttggccgattctcggattccttggtgcagaagggc
tataaggtggcccgagtggaacagactgagaccccagagatgatggaggcacggtgccgg
aaaatggcgcatgtgtctaagtttgatagagtggtgagaagggagatttgtaggatcatt
accaagggcacacagacctatagtgtgctggatggtgatccctccgagaactacagtagg
tatcttctgagcctcaaagagaaagaggaagattcttctggtcacatgcgtgcatatggt
gtgtgctttgttgatacttcactgggcaagtttttcctgggccagttttcagatgatcgc
cactgttccagacttaggactctagtggcacactatcctccagtacagattttgtttgag
aaaggaaatctctcaacagaaaccaaaacagtcctgaagggttcactgtcatcttgcctt
caggaaggcctgattccaggttcccaattttgggatgccactaagactttgcgaacactc
ctggagggagggtattttactggaaatgaaggcagtggtgcagagctgcccccggtgctt
aaagctatgacgtcagagtcagattctgttgggctgacaccaggagaggagagtgagtta
tctctgtctgctctaggtggttgtgttttctacctcaaaaaatgcctgattgatcaggag
cttctgtcaatggctaattttgaagagtattttcccttggattctgacatggttggcaca
gtaaaacctggtgctgtctttactaaagccagtcagcgaatggtgctagatgcggtgaca
ttaagcaacctggagattttcctgaatgggacaaatggctctactgaagggactctgcta
gagaggctggatacctgccataccccttttggcaagcgactcttaaaacagtggctttgt
gcccccctctgtagtccttctgctatcagtgaccgtctagatgccattgaagacctgatg
gctgtgcctgacaaagtcgccgaagttgcagacctcctgaagaagctgccagatcttgag
aggctactgagtaagattcataatgttgggtctcccctaaagagccagaaccatccagat
actagggctataatgtacgaagaaacgacatacagcaaaaaaaagatcatcgattttctt
tctgctctagaaggattcaaagtaatgtgtaaaattacaaggctcatggaggatgtcgct
gatgggtttaagtctaaaaccctgaagcaggttgtgactctgcaaacaaaaagtcctaaa
ggccgttttcctgatctgaccgcagaactgaaccgatgggatacagcttttgaccatgag
aaggctcgaaagactggactcattaccccaaaagcagggtttgactcagattatgaccaa
gcacttgctgacataagagagaatgaacagagcctcttggagtacttagacaaacagcgg
agtcggatcggctgtagaaacatagtctactggggaattggtaggaaccgttaccagtta
gagattccagagaattttgctacccgaaatctacctgaagaatatgagttgaagtctacc
aaaaagggctgtaaacgatactggaccaaagtgattgagaagaaactgtctaatcttata
aacgctgaggaacgcagggacgcatctttaaaggactgcatgcggcgtctgttctataac
tttgacaagaatcacaaggactggcagtctgctgtggagtgcactgcagtgctggatgtc
ttactgtgcctggctagctatagccaaggaggagatggcccgatgtgtcgcccagtactt
ctgttaccaggagaagacacacatcccttcttagagcttaaaggctcacggcatccctgc
attacaaagactttctttggagatgattttattcctaatgacattctgatcggctgtgag
gaagacgcagaggcggacggcaaagcctattgtgtgcttgttactgggccaaatatgggg
ggcaaatctacactcataagacaggctggtctgttagctgtgatggcccagatgggttgt
tatgtacctgccgagctgtgtaggctcacaccagtggatagagtgtttactcgacttggt
gcctccgatagaatcatgtcaggggaaagtacattttttgttgagttgagcgaaactgct
agcatactcaggcatgcgacagcacactctctggtacttgtggatgaattaggaagaggg
actgcaacttttgatgggacagcaatagccagtgcggttgttaaagaactcgctgaaacc
ataaagtgtcgaacactgttttctacacactatcattcattagtagaggattattctaaa
aatgtttgtgtgcgcctaggacatatggcatgcatggtggaaaatgaatgtgaggatccc
agccaggagaccattactttcctctataaattcattaagggagcttgtcctaagagctat
ggctttaatgcagcaaggcttgctaatcttccagaggaagttattcagaagggacacaga
aaagcaagagaatttgagaggatgaatcaggcattacaactatttcgggaagtttgtctg
gctagtgaaaggccgactgtaaacagtgaagctatccataggttgctggctttggttaac
caattgtag

KEGG   Rattus norvegicus (rat): 499505
Entry
499505            CDS       T01003                                 

Gene name
Msh3
Definition
(RefSeq) DNA mismatch repair protein Msh3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno03430  Mismatch repair
rno05200  Pathways in cancer
rno05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    499505 (Msh3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    499505 (Msh3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    499505 (Msh3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    499505 (Msh3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    499505 (Msh3)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     499505 (Msh3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV
Other DBs
NCBI-GeneID: 499505
NCBI-ProteinID: NP_001178886
RGD: 1563954
Ensembl: ENSRNOG00000013673
Position
2
AA seq 1105 aa
MPRRKSASGGSNAAGPDPGRQVVLSRFFKSAGSLRSSVSPTEPAEKVTEGDSRKRSLGNG
EPTNKKAKKVPEEEGENTSVASHNPEPKKCLRPRIVSKSLEKLKEFCCDSALPQNRVQTE
ALWERLAVLPKCTDFEDITLQRAKNAVLSEDSKSQANQKDTQFGPSPEAFQKTSTCKPFN
RRSKSIYTPLELQYLDVKQLHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMT
ASIPTHRLFVHVRRLVAKGYKVGVVKQTETAALKAIGDNKSSVFSRKLTALYTKSTLIGE
DVNPLIRLDDSVNIDEAVTDTSTNYLLCIYEEKENIKDKKKGNISFGIVGVQPATGEVVF
DCFQDSASRLELETRTASLQPVELLLPSQLSEPTEMLIRRATAVSVGDDRIRVERMNNTH
FEYSHAFQTVMEFYARETVDTQGSQSLSGVIHLEKPVICALAAIIRYLKEFNLDKVLSKP
ENFKQLSSGMEFMRINGTTLRNLEILQNQTDMKTRGSLLWVLDHTKTSFGRRKLKKWVTQ
PLLKLRDINARLDAISDVLHSESSVFEQIENLLRKLPDVERGLCSIYHKKCSTQEFFLIV
KNLCQLKSELQALMPAVNSHVQSDLLRARVLEVPELLSPVEPYLKVLNEQAAKAGDKTEL
FKDLSDFPLIKKRKNEIQEVIHSIQMHLQELRKILKLPSLQYVTVSGQEFMVEIKNSAVS
CVPTDWVKVGSTKAVSRFHSPFVVENYRRLNQLREQLVLDCNAEWLDFLENFGEHYHTLC
KAVDHLATVDCIFSLAKVAKQGSYCRPTLQEEKKIIIKNGRHPMIDVLLGEQDQFVPNST
NLSQDSERVMIITGPNMGGKSSYIKQVALVVIMAQIGSYVPAEEATIGIVDGIFTRRGAA
DNIYKGRSTFMEELTDTAEIIQKATQRSLVILDELGRGTSTHDGIAIAYATLEYFIRDVK
SLTLFVTHYPPVCELEKRYPEQVGNYHMGFLVNEDGSKQDSGDMEQMPDSVTFLYQITRG
IAARSYGLNVAKLADVPREILQKAAHKSKELEGLVNLRRKRLEYFIDLWTTHSVKDLHTR
AAELEIQEIQTSPHNEMKTTLLELK
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgccccgcaggaaatccgcgtcgggaggctctaatgccgccggcccagacccggggagg
caagtggttctgagccggttcttcaagtctgcgggaagcctaagatccagcgtgtccccc
acagaaccagcagagaaggtgacagaaggtgacagcaggaagaggtcactggggaatggt
gagcccactaacaagaaagcaaagaaagttccagaggaggaaggagaaaatacctcagta
gcatctcacaatcctgagccaaagaaatgtctgaggcccaggattgtttcaaagtccctg
gaaaagttgaaagaattctgctgtgattctgccctccctcaaaacagagtccagacagaa
gccctttgggagagacttgcagttctgccaaagtgtactgatttcgaagatatcactctg
caacgtgcaaagaatgcggttttgtccgaagattccaagtctcaggctaatcagaaagac
actcaatttggaccttcccctgaagctttccagaagacttccacttgtaaaccttttaac
aggcggtccaagagcatctatactccactagaactgcagtaccttgatgtgaagcagctg
cataaagacgcggttttgtgtgtggaatgtgggtacaagtacaggttctttggggaagat
gcagaaattgctgcccgggaactcaatatttattgccacttggaccacaactttatgacg
gcgagcatacccacccacagactgttcgtgcatgtccgccgactggtggccaaaggatac
aaggtgggagttgtgaagcaaactgaaactgcggcattaaaggccattggagacaataaa
agttctgtcttttcccggaaattgactgctctttatacgaaatccacactgattggagaa
gatgtgaatcctctgatcaggctggatgattctgtaaatattgatgaggcagtgacggat
acttctaccaactatcttctgtgtatctacgaagaaaaggaaaacattaaagacaaaaag
aaggggaacatttcttttggcatcgtgggagtgcagcctgcgacgggcgaggtcgtgttc
gactgcttccaggactcggcttccagactggagctggagactcgaacagcaagcctgcag
cccgtggagctgctgctcccctcacagctgtccgagccaacggagatgctcatccgtaga
gccaccgctgtcagtgttggggatgacagaattcgagtagaaaggatgaataatactcac
tttgaatacagccatgctttccagacagttatggagttctatgccagagagacagttgac
acccagggctctcagagcctgtctggtgtcattcacttggagaagcctgtgatctgcgcc
ctggctgccataatacggtacctcaaggaatttaacttggacaaggtgctgtccaaaccc
gagaattttaaacagctgtcaagtggaatggaattcatgagaatcaatggaacaacgcta
aggaatctggaaatcctacagaatcagactgatatgaagaccagaggaagtttgctttgg
gttttagaccacactaaaacctcatttgggagaaggaagttaaaaaaatgggttacccaa
ccattgcttaaattaagggacataaatgcccgacttgatgcaatatccgatgttctccac
tcagaatccagtgtgtttgaacagatagaaaaccttctacggaaactaccggatgtcgag
agaggactgtgtagcatttatcacaagaagtgctctactcaggagttcttcttgatcgtc
aaaaacctgtgtcaactcaaatcagagcttcaagcgttaatgcctgctgttaattcccac
gtacagtcagacttgctccgagcacgcgtcttagaagtgcctgagctcctcagtccagtg
gagccttatttaaaggttctgaatgaacaagctgccaaagctggcgataaaactgaatta
ttcaaagacctctctgacttccctttaataaaaaagaggaaaaatgaaattcaagaagtc
attcacagcatccaaatgcatttacaagaattgcgaaaaatattaaaacttccttcttta
caatatgtgactgtatcaggacaagagtttatggttgaaataaagaactcagctgtgtct
tgcgtcccgactgactgggtgaaggttggaagcacaaaagctgtgagccgctttcactct
ccttttgtcgtggaaaactacagacgtctgaatcaactccgggagcagctagtccttgac
tgcaatgctgaatggcttgactttctagagaattttggtgaacattaccacactttgtgt
aaggccgtggatcacctagcaactgtggactgcattttctccctggccaaggtcgccaag
caaggaagttactgcaggccaactctacaagaagaaaagaaaatcatcataaaaaatgga
aggcaccctatgattgatgtgttgctgggtgaacaagatcagtttgtgcccaacagtaca
aatttatcacaggactctgagagagtaatgataatcaccggaccgaacatgggtggcaag
agctcctacataaaacaggttgctctggttgtgatcatggctcagatcggctcctacgtt
cctgcagaggaagccacaattgggattgtggacggcattttcacaaggaggggtgctgca
gacaatatatacaaaggccggagtactttcatggaagagctgacagacacggcggagata
atccagaaagcaacacagcggtccctggttatcctggacgagctgggaagagggaccagc
acccacgacggaatcgccattgcctatgcgactctagagtattttatcagagacgtgaaa
tccttaaccctgttcgtcacccactatccaccagtctgtgaactagagaaacgttaccca
gagcaggtggggaattaccacatgggcttcttggtcaatgaggacggaagcaagcaggac
tcaggtgacatggagcagatgccggactctgtcactttcctctatcagataaccagagga
attgcagcgaggagttacggactgaatgtggcgaagctagcagatgtgcccagagaaatc
ttacagaaagctgctcacaagtctaaagagctggaaggcttagtcaatctgagaaggaaa
agacttgaatattttatagatctgtggacgacacatagtgtaaaggacctgcacacgcgg
gcagctgagctggaaatacaggaaatacagacgtctccccacaatgaaatgaaaactaca
cttttggagctgaagtag

DBGET integrated database retrieval system