KEGG   Rattus norvegicus (rat): 100360552
Entry
100360552         CDS       T01003                                 

Gene name
Fzd7
Definition
(RefSeq) frizzled-7 precursor
  KO
K02432  frizzled 1/7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100360552 (Fzd7)
   04390 Hippo signaling pathway
    100360552 (Fzd7)
   04150 mTOR signaling pathway
    100360552 (Fzd7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100360552 (Fzd7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100360552 (Fzd7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100360552 (Fzd7)
   05205 Proteoglycans in cancer
    100360552 (Fzd7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100360552 (Fzd7)
   05226 Gastric cancer
    100360552 (Fzd7)
   05217 Basal cell carcinoma
    100360552 (Fzd7)
   05224 Breast cancer
    100360552 (Fzd7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100360552 (Fzd7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100360552 (Fzd7)
   05022 Pathways of neurodegeneration - multiple diseases
    100360552 (Fzd7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100360552 (Fzd7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    100360552 (Fzd7)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  100360552 (Fzd7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR DUF6338
Other DBs
NCBI-GeneID: 100360552
NCBI-ProteinID: NP_001258114
RGD: 2321905
Ensembl: ENSRNOG00000016119
UniProt: D4ACM8
Position
9
AA seq 572 aa
MRGPGTEASHSPLGLCALVLALLGALPTDTGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYP
TAPYLPDPPFTAMSPSDGRGRWSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGL
MYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVA
HVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWF
LAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALR
GFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPA
TIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFSPMSPDFTVFMIKYLMTMIVGI
TTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgcggggccccggcacggaggcgtcgcactcgcccctgggcctctgtgccttggtgctt
gctcttctgggcgcgctgcccacggacaccggagctcaaccataccacggcgagaaaggc
atctcggtaccggaccacggcttctgccagcccatctccatcccgttgtgcacggatatt
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccagttctaccctctggtaaaggtgcagtgttctcccgagctgcgcttc
ttcttatgctctatgtacgcacccgtgtgcaccgtgctcgaccaagccattcctccgtgc
cgttccttgtgcgagcgcgcccgacagggctgcgaggcgctcatgaacaagttcggtttc
cagtggccggagcggctgcgctgcgagaacttcccggtgcacggcgccggcgagatatgc
gtggggcagaacacgtccgacggctccgggggcgcaggcggtagtcccaccgcctaccct
actgctccctacctgccagacccgcctttcactgcgatgtccccctcagatggcagaggc
cgctggtctttccccttctcttgcccgcgtcagctcaaggtccccccctacctgggctac
cgtttcctaggcgagcgtgactgcggtgccccgtgtgagccaggccgtgctaacggcctc
atgtactttaaagaagaggagagacgtttcgcccgcctctgggtaggtgtgtggtcagtg
ctgtgctgtgcctcgacgctcttcacggtgctcacctacctagtggacatgcgtcgcttc
agctatccagagcgacccattatcttcctgtcgggctgctacttcatggtggcagtggcg
cacgtggcgggcttcctgctagaggaccgtgccgtgtgcgtggagcgcttctcggacgat
ggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttcatggtg
ctttacttcttcggcatggccagctccatctggtgggtcattctttccctcacttggttc
ctggcagctggcatgaagtggggccacgaggccatcgaggccaactcgcagtactttcat
ctggccgcgtgggctgtgccagcggtcaagacaatcaccatcttggccatgggccaggtg
gatggtgacctactcagtggagtgtgctacgtgggcctgtctagtgtggatgcactgcgg
ggcttcgtgctggcgcccttgttcgtctacctcttcatcggtacgtccttcctgttggcc
ggctttgtgtctctctttcgcatccgcaccatcatgaagcacgatggcaccaagacggag
aagctggagaagctcatggtgcgcattggcgtcttcagcgtgctctacacggtcccagcc
accatcgtgctggcgtgctacttttacgagcaggccttccgcgagcactgggagcgcacc
tggctcctgcagacctgcaagagctacgctgtgccctgccccccgggccacttctcgccc
atgagccccgactttacagtcttcatgatcaagtacctgatgaccatgatcgtgggcatc
actaccggcttctggatctggtcgggcaagaccctgcagtcatggcgtcgcttctaccac
agactcagccacagcagcaagggggagactgcggtatga

KEGG   Rattus norvegicus (rat): 266608
Entry
266608            CDS       T01003                                 

Gene name
Fzd9
Definition
(RefSeq) frizzled-9 precursor
  KO
K02842  frizzled 9/10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    266608 (Fzd9)
   04390 Hippo signaling pathway
    266608 (Fzd9)
   04150 mTOR signaling pathway
    266608 (Fzd9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    266608 (Fzd9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    266608 (Fzd9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    266608 (Fzd9)
   05205 Proteoglycans in cancer
    266608 (Fzd9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    266608 (Fzd9)
   05226 Gastric cancer
    266608 (Fzd9)
   05217 Basal cell carcinoma
    266608 (Fzd9)
   05224 Breast cancer
    266608 (Fzd9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    266608 (Fzd9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    266608 (Fzd9)
   05022 Pathways of neurodegeneration - multiple diseases
    266608 (Fzd9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    266608 (Fzd9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    266608 (Fzd9)
   04090 CD molecules [BR:rno04090]
    266608 (Fzd9)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  266608 (Fzd9)
CD molecules [BR:rno04090]
 Proteins
  266608 (Fzd9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 266608
NCBI-ProteinID: NP_695217
RGD: 628817
Ensembl: ENSRNOG00000001452
UniProt: Q8K4C8
Position
12
AA seq 592 aa
MAVPPLLRGALLLWQLLATGGAALEIGRFDPERGRGPAPCQAMEIPMCRGIGYNLTRMPN
LLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQAR
LRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRP
ARPPGDSAPGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWS
ALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAG
ALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFH
MAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLT
GFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLR
ATEQPCTAAAVPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQS
LCYRKMAAGRARAKACRTPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggcggtgccaccgctgctccgcggggcgctgctgctgtggcagctgctggcgacgggc
ggcgcggcgctggagatcggccgctttgatccggagcgcggccgtggccccgcaccgtgc
caagcgatggagatccccatgtgccggggcatcggctacaacctgacccgcatgcccaac
ctactgggccacacgtcgcagggcgaggcggccgcgcagctggccgagttctcgcctctc
gtgcagtacggctgccacagccacctgcgcttcttcctctgctcgctctacgccccaatg
tgcaccgaccaggtctccactcccatccccgcctgccggcccatgtgcgagcaggctcgc
ctgcgctgcgcccccatcatggagcaattcaatttcggctggccggactccctcgactgt
gcccggctccccacgcgcaacgacccgcacgcgctctgcatggaggcacccgagaacgct
accgcaggccccacagaaccccacaagggcctgggcatgcttcctgtagcacctcggccc
gcgaggccaccgggagattcagcccccggtccgggcagtggaggcacctgcgacaacccc
gagaagttccagtacgtggagaagagtcgctcgtgcgctccgcgctgcgggccaggcgtc
gaggtgttctggtctcggcgcgataaggacttcgcgctggtctggatggctgtgtggtcc
gcgttgtgtttcttctccacggccttcaccgtgttcaccttcctgctggagcctcaccga
ttccagtacccagagcgccctataatcttcctttccatgtgctacaatgtctactccttg
gccttcctgatcagagcggtggcaggtgcacagagtgtggcctgcgaccaggaggcaggg
gctctgtatgtgatccaggagggtttggaaaacacaggctgcaccctggtcttcctattg
ctctattatttcgggatggccagctcactttggtgggtggttttgactctcacctggttc
ctggctgcaggcaaaaagtggggccacgaagccatcgaggctcacggtagttacttccac
atggcagcgtggggcttgccagcactcaagactatcgtggtcctgactctacgtaaggtg
gctggggatgagctgactgggctctgctatgtagctagcatggacccggcagctctcact
ggctttgtgttggtgcccctctcttgctacttggtactgggcaccagtttcctcctgaca
ggttttgtggctctcttccatatccgcaaaattatgaagacgggcggcaccaatacagag
aagctggagaagctgatggtgaaaatcggagtcttttccatcctttacacagtgccggct
acctgcgtcattgtctgctatgtttacgaacgcctcaacatggacttctggcgtcttcgg
gccacagagcaaccatgcactgccgctgccgtgcctggaggccggagagactgctcgctg
ccagggggctcggtgcccactgtggccgtcttcatgctcaaaatcttcatgtccttggtg
gtgggcatcaccagtggagtctgggtatggagttccaagactttccagacttggcagagt
ctatgttaccgaaaaatggcagctggtcgagcccgggccaaggcctgccgaaccccaggg
ggctatggccggggtacccactgtcactacaaagcccccacggtggtcttgcacatgact
aagacagacccctctctggagaaccccacacacctctag

KEGG   Rattus norvegicus (rat): 266715
Entry
266715            CDS       T01003                                 

Gene name
Fzd3
Definition
(RefSeq) frizzled-3 precursor
  KO
K02329  frizzled 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    266715 (Fzd3)
   04390 Hippo signaling pathway
    266715 (Fzd3)
   04150 mTOR signaling pathway
    266715 (Fzd3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    266715 (Fzd3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    266715 (Fzd3)
  09158 Development and regeneration
   04360 Axon guidance
    266715 (Fzd3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    266715 (Fzd3)
   05206 MicroRNAs in cancer
    266715 (Fzd3)
   05205 Proteoglycans in cancer
    266715 (Fzd3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    266715 (Fzd3)
   05226 Gastric cancer
    266715 (Fzd3)
   05217 Basal cell carcinoma
    266715 (Fzd3)
   05224 Breast cancer
    266715 (Fzd3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    266715 (Fzd3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    266715 (Fzd3)
   05022 Pathways of neurodegeneration - multiple diseases
    266715 (Fzd3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    266715 (Fzd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    266715 (Fzd3)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  266715 (Fzd3)
SSDB
Motif
Pfam: Frizzled Fz DUF4577
Other DBs
NCBI-GeneID: 266715
NCBI-ProteinID: NP_703204
RGD: 628814
Ensembl: ENSRNOG00000047211
UniProt: Q8CJC4
Position
15
AA seq 666 aa
MAVSWIVFYLWLLTVFLGQIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLVGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLVTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRKKKETVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctgtgagctggattgtcttttatctttggctcttgactgtgtttctggggcagata
ggtgggcacagtttgttttcttgtgaacctataaccttgaggatgtgccaagatttgcct
tacaatactaccttcatgcctaatcttctgaaccattatgaccagcagacagcagcttta
gcaatggagccattccaccctatggtgaacctggattgttctcgggattttcggccattt
ctttgtgcactctatgcccctatttgtatggaatatggacgtgtcacactcccctgccgt
aggctgtgtcagcgtgcctatagtgagtgctcaaagctcatggagatgtttggtgtcccc
tggcctgaagatatggagtgcagtaggtttccagattgtgatgagccatatccccgactt
gtggatttgaatttagttggagatccaactgaaggagccccagtggcagtacagagggat
tatggtttttggtgtccccgagagttgaaaattgatcctgaccttggctattcctttctg
cacgtgcgagattgttcaccaccatgtcccaatatgtacttcaggagagaagaactgtca
tttgctcgctatttcataggcctgatttcaatcatttgcctctctgccacattggttact
tttttaacctttctgattgacgtcacaagattccgttaccctgaaagacctatcatattt
tatgcagtctgctacatgatggtgtcattaattttcttcattgggtttttgcttgaggac
cgagtagcctgcaatgcatctagccctgcacagtataaggcttccacagtgacacaagga
tctcacaataaggcctgtaccatgctcttcatggtactctattttttcactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggc
agtgaagctattgagaaaaaagcattgctgtttcatgccagtgcctggggcatccccgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgctttgtcggcctctacgacgtagatgcattaagatattttgttcttgctcccctctgc
ctgtatgtggtagttggggtttctctcctcttagccggcattatatccctaaacagagtt
cggattgagatcccattagaaaaggaaaaccaagataagttagtgaagttcatgatccgg
atcggtgttttcagcattctctaccttgtcccactcttggttgtaattggatgttacttt
tatgagcaagcttaccgcggcatctgggaaacaacatggatacaggaacgctgcagagaa
tatcacattccgtgtccgtaccaggttactcagatgagtcgtccagacctgattctcttt
ctgatgaagtatctcatggctctcatagttgggattccctctattttttgggttggaagc
aaaaaaacatgctttgaatgggccagctttttccatgggcgtaagaaaaaagagacagtg
aatgagagccggcaggtgctccaggaacctgactttgctcagtcactcctgagggaccca
aatactccaattataagaaaatcaagaggaacttccactcaagggacatccacacatgct
tcttcaactcagctggccatggtggatgatcaaagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccatggcagcctccacaggtcacgtgatggcaggtacactccctgc
agttaccgagggatggaggagagactacctcacggcagcatgtcacggctgacagatcac
tccaggcacagtagttctcatcggctcaatgagcagtcccgacacagcagcatccgagac
ctcagcaacaaccccatgactcacattacacatggcaccagcatgaaccgtgttattgaa
gaggatggaaccagtgcttag

KEGG   Rattus norvegicus (rat): 282581
Entry
282581            CDS       T01003                                 

Gene name
Fzd6
Definition
(RefSeq) frizzled-6 precursor
  KO
K02376  frizzled 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    282581 (Fzd6)
   04390 Hippo signaling pathway
    282581 (Fzd6)
   04150 mTOR signaling pathway
    282581 (Fzd6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    282581 (Fzd6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    282581 (Fzd6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    282581 (Fzd6)
   05205 Proteoglycans in cancer
    282581 (Fzd6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    282581 (Fzd6)
   05226 Gastric cancer
    282581 (Fzd6)
   05217 Basal cell carcinoma
    282581 (Fzd6)
   05224 Breast cancer
    282581 (Fzd6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    282581 (Fzd6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    282581 (Fzd6)
   05022 Pathways of neurodegeneration - multiple diseases
    282581 (Fzd6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    282581 (Fzd6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    282581 (Fzd6)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  282581 (Fzd6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec
Other DBs
NCBI-GeneID: 282581
NCBI-ProteinID: NP_001124008
RGD: 628816
Ensembl: ENSRNOG00000004660
UniProt: G3V6L1
Position
7
AA seq 710 aa
MEASPFLSACILLPLIRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQGIAAVEMEH
FLPLANLECSPNIEMFLCQAFVPTCTEQIDVVSPCRKLCEKILSDCQKLMDTFGIRWPEE
LECHRLPYCDGAVPVTSDPHTELFGPQKKTDQVPRDIGFWCPKHLRTSGDQGYRFLGIDQ
CAPPCPNMYFKSDELDFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFVGFLLGNSTACNKADEKLELGNTVVLGSKNKACSVVFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGMPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYELVNRVTWEMTWFSDHCHQYRIPCPYQANPKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFCKRNRKRDPISESRRVLQESCEFFLKHNSKVRHK
KKHGKPGSHKLKVISKSMGTSTGVTTDHGTSAVAIADHDYLGQETSAEVQTSPEASLKEG
RADRANTPRAKGPDCGEPASTAASNSKFSGDQIDRKSRAGSVKEKSSVSEGAPSEGRVSP
KGVPGTGLMECTLQIPSSPEPNSLKGSTSLLVRSASGTRKEQGAGGHSDT
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggaagcgtccccgtttctgtcggcctgcattcttctgcccctcataagagggcacagc
cttttcacctgtgagccaatcactgttcccagatgtatgaaaatggcctacaacatgacg
tttttccctaacctgatgggtcattatgaccagggcattgctgctgtggaaatggagcac
tttctgcctcttgcaaatctggaatgttcaccaaacattgaaatgtttctttgccaagct
tttgtaccaacctgcacagagcaaattgatgtggtttcaccttgtcggaaattgtgtgag
aaaatactttctgattgccaaaagttaatggacacttttgggatccgatggcctgaagaa
cttgaatgtcacagattgccgtactgtgatggcgctgttcctgttacttctgatccacac
acagagctttttggtccacagaagaaaacagatcaagtcccaagggacattggattttgg
tgtccaaagcaccttaggacttccggggaccaaggctataggtttctgggaattgaccag
tgtgcccctccgtgtcctaacatgtactttaaaagtgatgaactagactttgccaaaagt
ttcataggaatagtttcaatattttgtctttgtgcaactttgttcacgtttcttactttt
ttaattgacgtcagaagattcaggtacccagagagaccaattatatactactccgtctgt
tacagcatcgtctctctcatgtactttgttgggtttttgctgggcaatagcacagcttgt
aataaggcagatgagaagctggaactcgggaacacagtcgttctagggtcaaagaataag
gcttgcagcgtggtgtttatgtttctgtactttttcacaatggccggcaccgtgtggtgg
gtgatcctcaccattacgtggttcttagccgccggaagaaaatggagttgcgaagctatt
gaacaaaaagcagtgtggtttcacgccgttgcctgggggatgcccgggttcctgactgtc
atgctgctcgctatgaacaaggttgaaggagacaacattagcggcgtttgcttcgttggc
ctgtatgacttagatgcctcccgctacttcgtccttctgcctctgtgcctctgtgtgttt
gttgggctgtctctcctcttagctggcatcatttccttaaatcacgttcgacaagttata
caacatgatggccgaaaccaagagaagctcaagaagttcatgatccgcattggagtcttc
agtggcctgtatcttgtgcccttagtgacgcttcttggctgctatgtctatgagctagtg
aacagggtcacctgggagatgacgtggttctctgatcactgtcaccagtaccgcatcccg
tgtccttaccaggcaaacccaaaagctcgaccagaattggctttatttatgataaaatat
ctgatgacattaattgttggtatctctgcggtcttctgggttggaagcaaaaagacgtgc
acagaatgggccgggttctgtaagcgaaaccgcaagcgcgaccccatcagtgagagccga
agagtgctgcaagagtcctgtgagttcttcctgaagcacaattccaaagtgaggcacaag
aagaagcatggcaaaccaggctcacataaactgaaggtcatttccaagtccatgggaact
agcacgggcgtgaccacagaccatggcacctctgccgtagcaattgccgaccatgattac
ttagggcaggaaacttcagcagaagtccagacctccccagaagcatccctgaaagagggg
agagcagaccgagcaaacacgcccagagccaaaggtccagactgtggagaacctgcttcc
acagcagcgtccaactccaagttctctggggaccagatcgacaggaaaagccgagcaggc
agcgtgaaggagaaaagcagcgtatcggaaggggctccaagtgaaggaagggtaagtcca
aagggcgttcctgggactggcctgatggagtgcactttacagatccccagctctccagaa
ccaaacagcctcaaaggttccacatctctgcttgttcgctcagcttccggaactaggaaa
gagcagggtgctggcggccattctgatacttga

KEGG   Rattus norvegicus (rat): 317674
Entry
317674            CDS       T01003                                 

Gene name
Fzd5
Definition
(RefSeq) frizzled-5 precursor
  KO
K02375  frizzled 5/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    317674 (Fzd5)
   04390 Hippo signaling pathway
    317674 (Fzd5)
   04150 mTOR signaling pathway
    317674 (Fzd5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    317674 (Fzd5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    317674 (Fzd5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    317674 (Fzd5)
   05205 Proteoglycans in cancer
    317674 (Fzd5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    317674 (Fzd5)
   05226 Gastric cancer
    317674 (Fzd5)
   05217 Basal cell carcinoma
    317674 (Fzd5)
   05224 Breast cancer
    317674 (Fzd5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    317674 (Fzd5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    317674 (Fzd5)
   05022 Pathways of neurodegeneration - multiple diseases
    317674 (Fzd5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    317674 (Fzd5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    317674 (Fzd5)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  317674 (Fzd5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 317674
NCBI-ProteinID: NP_776210
RGD: 631406
Ensembl: ENSRNOG00000014678
UniProt: Q8CHL0
Position
9
AA seq 585 aa
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGG
ECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGVCYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGSDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCS
SRRGHKSGGAMVAGDYAEASAALTGRTGPPGPAAAYHKQVSLSHV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggctagacccgacccgtccgcgccgccctctcttctgctgctgttgctggcacagctg
gtgggccgggcagcggccgcctccaaggccccagtgtgccaggaaatcacggtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccatgacactcag
gacgaagcaggcctggaggtgcaccaattctggccgctggtggagatccactgttccccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgcttgcctgactaccacaag
ccgctaccaccgtgccgctccgtgtgcgagcgcgccaaggccggctgctcgccactcatg
cgccagtacggcttcgcctggcccgagcgcatgagctgcgaccgcctcccagtgctgggc
ggcgacgctgaggttctgtgcatggattataaccgaagtgaagccaccaccgcgtcccct
aagtccttcccggccaaacccacactcccaggaccaccaggggcgccatcttccgggggc
gaatgtccctcgggaggcccgtctgtgtgcacgtgccgcgagcccttcgtgcccatcctg
aaggagtcacacccactctacaacaaggtgcgcaccggccaagtgcccaactgcgcagtg
ccctgctaccagccgtccttcagcccggatgagcgcacgttcgccaccttctggattggc
ctgtggtctgtgctgtgcttcatctccacgtccaccactgtagcgaccttcctcattgac
atggaacgattccgctaccctgagcgccccatcatcttcctgtctgcgtgctacctgtgt
gtgtcactgggattcttggtgcgcctggttgtaggccatgccagcgtcgcctgcagccga
gagcacagccacattcactatgagactaccggccctgcgctgtgcacagtcgtcttcctc
ttagtctacttctttggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcggctggcatgaagtggggcaatgaagccatcgcaggctatgcacagtacttc
caccttgctgcctggctcatccccagcgtcaagtccattacggcgctggcactgagctcc
gtggacggagacccagtggctggcgtctgttatgtgggcaaccaaaacctgaactcgcta
cgaggctttgtcttgggcccactggtgctgtacctgttggtgggcacgctcttccttctg
gcaggcttcgtgtcactcttccgcatccggagcgtcatcaagcagggtggcactaagacg
gacaagctagagaagctcatgatccgcattggcatcttcactctgctctacacggtgcca
gccagcatcgtggtggcctgctacctgtatgaacagcactatcgggagagctgggaggca
gccctcacctgcgcgtgtccggggtcggacgctggccagccacgcgccaaacccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggagtctgg
atctggtccggaaagaccctggagtcttggcggcgcttcaccagccgctgctgctgcagc
tctcgacggggccataaaagcggtggcgctatggtcgcaggagactatgcggaggccagc
gccgcactcactggcaggaccgggccgccgggccccgcggccgcataccacaagcaagtg
tccctgtcgcacgtatag

KEGG   Rattus norvegicus (rat): 363913
Entry
363913            CDS       T01003                                 

Gene name
Fzd10
Definition
(RefSeq) frizzled-10 precursor
  KO
K02842  frizzled 9/10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    363913 (Fzd10)
   04390 Hippo signaling pathway
    363913 (Fzd10)
   04150 mTOR signaling pathway
    363913 (Fzd10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    363913 (Fzd10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    363913 (Fzd10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    363913 (Fzd10)
   05205 Proteoglycans in cancer
    363913 (Fzd10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    363913 (Fzd10)
   05226 Gastric cancer
    363913 (Fzd10)
   05217 Basal cell carcinoma
    363913 (Fzd10)
   05224 Breast cancer
    363913 (Fzd10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    363913 (Fzd10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    363913 (Fzd10)
   05022 Pathways of neurodegeneration - multiple diseases
    363913 (Fzd10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    363913 (Fzd10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    363913 (Fzd10)
   04090 CD molecules [BR:rno04090]
    363913 (Fzd10)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  363913 (Fzd10)
CD molecules [BR:rno04090]
 Proteins
  363913 (Fzd10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 363913
NCBI-ProteinID: NP_001258121
RGD: 1583825
Position
12
AA seq 582 aa
MQHPGPRLWLMLQVMMGSCAAISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHE
NQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSP
IMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQE
HPLKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCF
FSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYV
IQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGRKWGHEAIEANSSYFHLAAW
AIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVA
LFHIRRVMKTGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQH
KCKTNNQTKTADCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQQVCSRGL
KRKSRRKPASVVTSAGIYKKAQHPQKPHLGKYELPAQPSACV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgcaacacccgggcccacgcctgtggctgatgctgcaggtaatgatgggttcgtgcgcg
gccatcagctccatggacttagagcgccctggagacggcaagtgccagccggtggagatt
cccatgtgcaaggacatcggctacaacaccacccgcatgcccaacctgatgggccacgag
aaccagcgggaggcggccatccaactgcatgagttcgcgccgctcgtggagtacggctgc
cacggccacctccgcttcttcttgtgctcgctgtacgcgcccatgtgcaccgagcaggtc
tccacacccatccctgcttgccgggtcatgtgcgagcaggcccggctcaagtgctcgccg
atcatggagcagtttaaattcaggtggccggactccctggattgcagcaaactccccaac
aagaacgatcccaactacctgtgcatggaggcacccaacaacggctccgatgagcccagc
cgtggctctggcatgttccctccgctcttcaggccccagaggccccacagcgcgcaagag
cacccactaaaggacgggggtcccgggcgcgcaggctgtgacaacccaggcaagttccac
cacgtggagaagagcgaatcctgcgcaccgctctgcactccgggggtggatgtgtattgg
agccgcgacgacaagcgcttcgctgtggtctggctggccatctggtccgtgctgtgtttc
ttctccagcgccttcaccgtgctcaccttcctcatcgacccatcacgcttcaggtacccc
gaacgtcccatcatctttctctccatgtgctactgcgtttattctgtgggctatatcatc
cgcctcttcgcgggcgcggagagcattgcctgcgaccgggacagtgggcagctgtatgtt
atccaggaagggctggagagcacgggctgtaccttagtcttcttggtactttactacttc
ggcatggccagctctttatggtgggtggttctcaccctcacttggttcctggctgctggc
aggaagtggggccatgaggccattgaagccaacagcagctactttcacctggcagcctgg
gccatcccggctgtgaagaccatcttgatcctggtgatgcgcagggtggcaggggatgag
ctcactggtgtgtgttatgtgggcagcatggatgtcaatgctctgaccggcttcgtgctg
gtcccgctggcttgctacctagtcatcggcacttccttcatcctgtctggctttgtggct
ttattccacatccggagggtgatgaaaacaggtggggagaacacggacaagctggagaag
ctcatggtacgcataggggtcttctccctcctctacaccgtgccggccacctgtgtgatt
gcttgttacttttatgaacgcctcaacatggattactggaagatgctggccacccagcac
aagtgtaaaacgaacaatcagaccaagacagccgactgcctgatgaccacctccatccct
gctgtggaggtcttcatggtcaaagtgtccatgcttctggtggtgggcattaccagtggg
gtgtgggtctggacttccaagaccctgcaatcctggcaacaggtatgcagccgggggtta
aagagaaaaagccggaggaaaccagccagtgtggtcaccagtgcagggatctacaaaaaa
gcccagcacccccaaaaacctcatcttgggaagtatgagcttcctgctcagccttcagcc
tgcgtgtga

KEGG   Rattus norvegicus (rat): 364754
Entry
364754            CDS       T01003                                 

Gene name
Fzd8
Definition
(RefSeq) frizzled-8 precursor
  KO
K02375  frizzled 5/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    364754 (Fzd8)
   04390 Hippo signaling pathway
    364754 (Fzd8)
   04150 mTOR signaling pathway
    364754 (Fzd8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    364754 (Fzd8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    364754 (Fzd8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    364754 (Fzd8)
   05205 Proteoglycans in cancer
    364754 (Fzd8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    364754 (Fzd8)
   05226 Gastric cancer
    364754 (Fzd8)
   05217 Basal cell carcinoma
    364754 (Fzd8)
   05224 Breast cancer
    364754 (Fzd8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    364754 (Fzd8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    364754 (Fzd8)
   05022 Pathways of neurodegeneration - multiple diseases
    364754 (Fzd8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    364754 (Fzd8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    364754 (Fzd8)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  364754 (Fzd8)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 364754
NCBI-ProteinID: NP_001037716
RGD: 1560525
Ensembl: ENSRNOG00000061031
UniProt: Q498S8
Position
17
AA seq 684 aa
MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPQPGEQPPSGS
GHSRPPGARPPHRGGSSRGSGDTAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSSE
RHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDME
RFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAATAGAGAA
GAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFL
AAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRG
FVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVP
AAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVW
VWSGKTLESWRALCTRCCWASKGAAVGAGAGGSGPGGGGPGPGGGGGHGGGGGSLYSDVS
TGLTWRSGTASSVSYPKQMPLSQV
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgctactagccgccttggcggtgctacag
cgctcgagcggcgctgccgcggcttcggccaaggagctggcgtgccaagagatcacagtg
ccgctgtgcaagggcatcggttacaactacacctacatgcccaaccagttcaaccacgac
acgcaagatgaggcgggcctagaggtacaccagttctggccgctggtggagatccagtgc
tccccggacctcaagttctttctgtgtagcatgtacacgcccatctgcctggaggactac
aagaaacctctgccgccttgccgctctgtgtgtgaacgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggctttgcctggcctgaccgaatgcgctgcgatcggctgccggag
cagggcaaccccgacactctgtgcatggactacaaccgcaccgacctcaccacggccgcg
cccagcccaccgcgccgcctgccgccgccgcagcctggcgagcagccgccctccggcagc
ggccacagccgcccgccaggggccaggcccccacatcgtggcggcagcagtaggggcagc
ggggacacggcggctgcgcccccctctcgcggcgggaaggcgaggccccctggtggcggc
gccgctccctgcgagcccgggtgccagtgccgcgcgcccatggtgagtgtgtccagcgaa
cgccacccgctctacaaccgcgtcaagaccggccagatcgccaactgtgcgctgccctgc
cacaaccccttctttagccaggatgagcgcgccttcactgtcttctggatcggcttgtgg
tcggtgctctgcttcgtctccaccttcgccactgtctctaccttcctcatcgatatggag
cgctttaagtacccggaacggcccattatattcctctctgcctgctacctcttcgtgtct
gtcgggtacctggtgcgcctggtggctggacacgagaaagtggcctgcagcggcggcgcg
ccgggtgcaggaggagctgggggtgctggcggcgcggcgaccgctggcgcgggggcggcg
ggagcgggggcgagcagcccgggcgcgcgcggcgagtacgaggagctgggtgcagtggag
cagcacgtgcgctatgagaccactggccccgcgctgtgcacggtagtcttcctccttgtc
tacttttttggcatggctagctccatctggtgggtaatcctgtctctcacgtggttcttg
gcggctggtatgaaatggggcaacgaggccatagcaggctactcgcaatacttccacctt
gccgcgtggctcgtgcccagcgtcaagtccatagcggtgctggcgctcagctccgtggac
ggcgacccggtggcgggcatctgctacgtgggcaaccagagccttgacaacctacgcggc
tttgtactggcgccactggtcatctacctcttcattgggactatgtttctgttagctggc
ttcgtgtcgctgttccgaatccgctcagtcatcaagcaacaaggaggcccaaccaagact
cacaagctagaaaagctcatgatccgcttgggcctcttcaccgtgctctacacggtgccc
gccgccgtcgttgtcgcctgccttttctatgagcagcacaaccgaccgcgctgggaggcc
acgcacaactgcccatgccttcgcgacctgcagccagaccaggctcgcaggcccgactac
gcggtcttcatgctcaagtacttcatgtgcctagtggtgggcatcacatcaggcgtgtgg
gtctggtccggcaagactctggagtcctggcgtgcgttgtgtactcgctgctgctgggcc
agcaagggcgctgcagttggcgcgggcgccggaggcagcggccctgggggcggtggcccc
gggcccggtgggggtggggggcacggcggaggtgggggatccctctacagcgacgtcagc
accggcctgacgtggcggtctggcacggccagctctgtatcttaccctaagcaaatgcca
ttgtcccaagtctga

KEGG   Rattus norvegicus (rat): 58868
Entry
58868             CDS       T01003                                 

Gene name
Fzd1
Definition
(RefSeq) frizzled-1 precursor
  KO
K02432  frizzled 1/7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    58868 (Fzd1)
   04390 Hippo signaling pathway
    58868 (Fzd1)
   04150 mTOR signaling pathway
    58868 (Fzd1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    58868 (Fzd1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    58868 (Fzd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    58868 (Fzd1)
   05205 Proteoglycans in cancer
    58868 (Fzd1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    58868 (Fzd1)
   05226 Gastric cancer
    58868 (Fzd1)
   05217 Basal cell carcinoma
    58868 (Fzd1)
   05224 Breast cancer
    58868 (Fzd1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    58868 (Fzd1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    58868 (Fzd1)
   05022 Pathways of neurodegeneration - multiple diseases
    58868 (Fzd1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    58868 (Fzd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    58868 (Fzd1)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  58868 (Fzd1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 58868
NCBI-ProteinID: NP_067089
RGD: 61916
Ensembl: ENSRNOG00000016242
UniProt: G3V833
Position
4
AA seq 642 aa
MAEEAVPSESRAAGRPSLELCAVALPGRREEVGHQDTAGHRRPRADSRCWARGLLLLLWL
LEAPLLLGVRAQAAGQVSGPGQQAPPPPQPQQGGQQYNGERGISIPDHGYCQPISIPLCT
DIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALP
PCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPE
FWTSNPQHGGGGYRGGYPGGAGPVERGKFSCPRALRVPSYLNYHFLGEKDCGAPCEPTKV
YGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAV
AVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSL
TWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVD
ALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYT
VPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQGGGGVPPHPPMSPDFTVFMI
KYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1929 nt   +upstreamnt  +downstreamnt
atggctgaggaggcggtgcctagcgagtcccgggccgccggccggccgagcttggaactt
tgtgccgtagcactccccggccggcgggaggaggtggggcaccaggacacggctggccac
cgccggccccgggctgactcccggtgctgggctagagggctactgctgcttctttggctg
ctggaggctcctctgcttttgggggtccgagcgcaggcggcgggccaggtatccgggccg
ggccagcaagctccgccgccgccccagccacagcagggcgggcagcagtacaacggcgaa
cggggcatctccatcccggaccacggctactgtcagcccatctccatcccgctgtgcacg
gacatcgcgtacaatcagaccatcatgcccaacctgctgggccacacgaatcaggaggac
gccggcctggaggtgcaccagttctacccgttggtgaaggtgcagtgctcagccgagctc
aagttcttcctgtgctccatgtacgcgcctgtgtgcaccgtactggagcaggcgctgccg
ccctgccgctccctgtgcgagcgcgcgcgccagggctgcgaggcactcatgaacaagttc
ggcttccagtggccagacacgctcaagtgcgagaagttccctgtgcacggcgcaggagag
ctgtgcgtgggccagaacacttccgacaaaggcaccccgactccctccttgctgccggag
ttctggaccagcaatccgcagcacggcggcggtggttaccgcggcggctacccgggaggt
gccggccccgtggagcggggaaagttctcctgcccgcgcgccctcagggtgccttcctac
ctcaactatcactttctgggggagaaggactgcggcgcgccctgcgaacccactaaagta
tacgggctcatgtacttcgggcctgaggagttgcgcttttcgcgcacctggataggcatc
tggtcggtgctgtgctgcgcctccacgctcttcacggtgctcacgtacctagtagacatg
cggcgcttcagctacccggagcggcccattattttcctgtccggctgttacacagcggtg
gcggtggcctatatcgccggctttctgttggaggaccgggtggtgtgcaacgacaagttt
gcagaggacggggcgcgcacggtggcgcagggcactaagaaggaggggtgcaccatcctc
tttatgatgctctacttcttcagcatggccagctccatctggtgggtaatcctgtccctc
acctggttcctggcagccggcatgaagtggggccacgaagccatcgaggccaactcacaa
tattttcacctagccgcctgggctgtaccagccattaaaactataaccatcctggcgctg
ggccaagtggatggcgacgtactgagtggagtgtgttttgtggggctcaataacgtggat
gctctgcggggctttgtgctggcgccgctcttcgtctatctgttcatcggcacctctttc
ctgctggctggtttcgtgtcgctcttccgcatccgcaccatcatgaagcatgacggcacc
aagacagagaaactggaaaagctcatggtgcgcatcggagtcttcagtgtgctctacacc
gtgccggccaccatcgtcatcgcctgctacttctatgagcaggcctttcgggaccagtgg
gagcgcagctgggtggcccagagctgcaagagttatgccatcccttgccctcacctccaa
ggaggtggaggcgtcccaccacacccacccatgagccccgactttacagtcttcatgatc
aagtatctcatgacgctaattgtgggcatcacatcaggcttctggatctggtccggcaag
acactgaattcctggaggaagttctacacgaggcttaccaacagcaaacagggggagact
accgtctga

KEGG   Rattus norvegicus (rat): 64512
Entry
64512             CDS       T01003                                 

Gene name
Fzd2
Definition
(RefSeq) frizzled-2 precursor
  KO
K02235  frizzled 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    64512 (Fzd2)
   04390 Hippo signaling pathway
    64512 (Fzd2)
   04150 mTOR signaling pathway
    64512 (Fzd2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    64512 (Fzd2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    64512 (Fzd2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64512 (Fzd2)
   05205 Proteoglycans in cancer
    64512 (Fzd2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    64512 (Fzd2)
   05226 Gastric cancer
    64512 (Fzd2)
   05217 Basal cell carcinoma
    64512 (Fzd2)
   05224 Breast cancer
    64512 (Fzd2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    64512 (Fzd2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    64512 (Fzd2)
   05022 Pathways of neurodegeneration - multiple diseases
    64512 (Fzd2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    64512 (Fzd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    64512 (Fzd2)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  64512 (Fzd2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 64512
NCBI-ProteinID: NP_742032
RGD: 71012
Ensembl: ENSRNOG00000021962
UniProt: Q08464
Position
10
AA seq 570 aa
MRARSALPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQT
IMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICE
RARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGTPALLTTAPPSGLQPG
AGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMF
FSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYI
AGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLA
AGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGF
VLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATI
VIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITS
GFWIWSGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgcgggcccgcagcgccctgccccgcagcgccctgccccgcctgctgctgccactgctg
ctgctgccggctgccgggccggctcagttccacggggagaagggcatctccatcccggac
cacggcttctgccagcccatctccatcccgctgtgcacggacatcgcctacaaccagacc
atcatgcccaaccttcttgggcacacgaaccaagaggacgcgggcctggaggtgcatcaa
ttctacccgctggtgaaggtgcagtgctcgcccgagctgcgcttcttcctgtgctccatg
tacgctccggtgtgcacggtgctggagcaggccatcccgccgtgccgctccatctgcgag
cgcgcgcgccaaggctgcgaggcgctcatgaacaagttcggcttccagtggcccgagcgc
ctccgctgcgagcatttcccgcgtcacggcgcggagcagatctgcgtgggccagaaccac
tccgaggacggaactcctgcgctactcaccaccgcgccaccgtctgggctgcagcctggc
gctggtggcaccccgggcggccctggcggtggtggcgcgcccccgcgctacgccactctg
gagcaccctttccactgtccccgcgtcctcaaggtgccgtcctatctcagctataagttt
ctgggtgagcgcgattgtgccgcgccctgcgagcctgcacggcccgacggctccatgttc
ttctcgcaggaggagactcgttttgcccgtctctggatcctcacatggtcggtgctgtgc
tgcgcttctactttcttcacggtcaccacctatttagtggacatgcagcgattccgctac
ccagagcggcccatcatcttcctgtccggttgctacaccatggtgtcagtggcctacatt
gcgggcttcgtgctccaggagcgcgtggtgtgcaacgagcgcttctctgaggacggttat
cgcacggtggtgcagggcactaagaaagaaggctgtactatactcttcatgatgctgtac
ttcttcagtatggccagctccatctggtgggtgattctgtccctcacctggttcctggca
gccggtatgaagtggggccacgaggccatcgaggccaattcgcagtacttccacctggcc
gcctgggcggtgccggccgtcaaaaccatcaccatcctggccatgggccagatcgacggc
gacctgctgagcggcgtgtgcttcgtgggcctcaacagcctggacccgctgcgaggcttc
gtgctggcgccgctcttcgtgtacctgttcatcggcacatccttcctgctggcgggcttc
gtgtcactcttccgcatccgcaccatcatgaagcacgacggcaccaagacggagaagctg
gagaggctcatggtgcgtatcggcgtcttctccgtgctctacaccgtaccggccaccatc
gtcatcgcctgctacttctatgagcaggccttccgcgagcactgggagcgctcgtgggta
agccagcactgcaagagcctagccatcccctgcccggcccactacacgccccgcatgtcg
cccgacttcacagtctacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcg
ggcttctggatctggtccggcaagacgctgcactcgtggaggaagttctacacgcgtctc
accaacagccggcatggagagaccaccgtgtga

KEGG   Rattus norvegicus (rat): 64558
Entry
64558             CDS       T01003                                 

Gene name
Fzd4
Definition
(RefSeq) frizzled-4 precursor
  KO
K02354  frizzled 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    64558 (Fzd4)
   04390 Hippo signaling pathway
    64558 (Fzd4)
   04150 mTOR signaling pathway
    64558 (Fzd4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    64558 (Fzd4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    64558 (Fzd4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64558 (Fzd4)
   05205 Proteoglycans in cancer
    64558 (Fzd4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    64558 (Fzd4)
   05226 Gastric cancer
    64558 (Fzd4)
   05217 Basal cell carcinoma
    64558 (Fzd4)
   05224 Breast cancer
    64558 (Fzd4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    64558 (Fzd4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    64558 (Fzd4)
   05022 Pathways of neurodegeneration - multiple diseases
    64558 (Fzd4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    64558 (Fzd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    64558 (Fzd4)
   04090 CD molecules [BR:rno04090]
    64558 (Fzd4)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  64558 (Fzd4)
CD molecules [BR:rno04090]
 Proteins
  64558 (Fzd4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 64558
NCBI-ProteinID: NP_072145
RGD: 71017
Ensembl: ENSRNOG00000016848
UniProt: Q9QZH0
Position
1
AA seq 538 aa
MAWQGTGPSVRGMPGGVRLRLGLLLLQLLLLQRPALGFGDEEERRCDPIRIAMCQNLGYN
VTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGG
MCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGE
ECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVL
TFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKN
TGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKT
IVILIMRLVDADELTGLCYVGNQSLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSN
LQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEML
KIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggcttggcagggcacagggccaagcgtccgggggatgcctggaggcgtcaggctcagg
ctggggctgctgctgctgcagttgctcctgctccagcggcccgccctggggttcggggac
gaggaggagcggcgttgcgaccccatccgcatcgccatgtgccagaacctcggctacaac
gtgaccaagatgcccaacttagtgggacacgagctgcagacagacgcggagctgcagctg
acaactttcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgt
tcggtttatgtgccaatgtgcacagagaagatcaacatccccatcggcccgtgcggtggc
atgtgtctttcagtcaagagacgatgtgaaccagtcctgaaagaatttgggtttgcctgg
ccggacagcctgaactgcagcaagttcccaccccagaacgaccacaaccacatgtgcatg
gaaggaccaggtgacgaagaggtacccttgccccacaaaactcccatccagccgggggaa
gagtgccactccgtgggaaccaattccgatcagtacatctgggtgaaaaggagcctgaac
tgtgttctcaagtgtggctacgatgctggcttgtacagccgctcagctaaggagttcacg
gatatttggatggccgtgtgggccagcctctgcttcatctctaccaccttcactgtgctg
accttcctgattgattcgtccaggttttcttaccctgagcgccccatcatattcctcagt
atgtgctataatatttatagcattgcttatattgttcggcttactgtaggccgggaaagg
atatcctgtgattttgaagaggcggcagaacccgttctcatccaagagggacttaagaac
acaggatgtgcaataattttcttgctgatgtacttttttggaatggccagctccatttgg
tgggttattctgacactcacttggtttttggcagccggactcaagtggggtcacgaagcc
attgaaatgcacagttcttatttccacatcgcagcctgggctatccctgccgtgaaaacc
attgtcatcttgattatgagactagtggatgccgatgagctgactggcctgtgctatgtc
gggaaccaaagcctagatgccctcaccggctttgtggtggcacctctctttacctatttg
gtgattggaactctattcattgctgcaggcttggtggccctcttcaaaattcggtcaaat
cttcaaaaagatgggaccaagacagacaagttggaaaggctaatggtcaagatcggggtc
ttctcggtcctgtacacggttcctgcgacctgtgtgattgcctgttatttctatgaaatc
tcaaactgggcactctttcggtattctgcagatgactcaaacatggcagttgaaatgttg
aaaatttttatgtctttgctcgtgggcatcacttcaggcatgtggatttggtctgccaaa
actcttcacacgtggcaaaaatgttctaaccgattggtgaattctgggaaggtaaagaga
gagaagagggggaatggttgggtgaagccagggaaaggcaacgaaactgtggtgtag

DBGET integrated database retrieval system