KEGG   Rattus norvegicus (rat): 100360754
Entry
100360754         CDS       T01003                                 

Symbol
Hist1h2ai
Name
(RefSeq) histone H2A type 1-B
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100360754 (Hist1h2ai)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100360754 (Hist1h2ai)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100360754 (Hist1h2ai)
  09165 Substance dependence
   05034 Alcoholism
    100360754 (Hist1h2ai)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100360754 (Hist1h2ai)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100360754 (Hist1h2ai)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100360754 (Hist1h2ai)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100360754 (Hist1h2ai)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 100360754
NCBI-ProteinID: XP_002728525
RGD: 2321504
Ensembl: ENSRNOG00000058437
UniProt: G3V9C0
Position
17
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgtgggaagcagggcggcaaggctcgcgccaaggccaagacccggtcctcc
cgggcgggcctgcagttccccgtgggccgcgtgcaccgtctgctgcgcaagggcaactac
tcggagcgggtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcagcgagggacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcacagggcggcgtcctgcccaacatccaggcggtgctgctgcccaagaag
acagagagccaccataaggccaagggaaagtaa

KEGG   Rattus norvegicus (rat): 100363171
Entry
100363171         CDS       T01003                                 

Name
(RefSeq) histone H2A-Bbd type 1
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100363171
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100363171
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100363171
  09165 Substance dependence
   05034 Alcoholism
    100363171
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100363171
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100363171
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100363171
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100363171
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 100363171
NCBI-ProteinID: XP_002730244
RGD: 2324719
Position
X
AA seq 108 aa
MAGKRRRRNISRSRRAELQFPVSRVDRFLREGNYSRRLSSSAPVFLAGVLEYLTSNILEL
AGEEAHTSGRKRISPEHLCRVVQNNDQLHQLFKEGTKSVFESADPDEN
NT seq 327 nt   +upstreamnt  +downstreamnt
atggccgggaaaaggcgaagacggaacatatcccgctcaagaagagctgagcttcagttt
ccagtcagccgtgtagaccgcttcctccgggagggaaactattctagacggctgagttcc
tctgcacccgtgttccttgcgggtgttctcgagtacctgacatccaacatccttgaactg
gctggtgaagaggcccacaccagtggcaggaagcgcatatctccagaacatttgtgccgg
gtggtacagaacaacgaccagctccaccaactcttcaaagaaggcaccaagtctgtgttt
gagtcagcagatcctgatgagaactga

KEGG   Rattus norvegicus (rat): 100910554
Entry
100910554         CDS       T01003                                 

Name
(RefSeq) histone H2A type 1-B-like
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100910554
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100910554
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100910554
  09165 Substance dependence
   05034 Alcoholism
    100910554
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100910554
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100910554
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100910554
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100910554
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 100910554
NCBI-ProteinID: XP_003751759
RGD: 6497956
Ensembl: ENSRNOG00000051758
UniProt: M0RCL5
Position
17
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGSYSERVGAGAPVYLAAVMEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESYHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgcggcaagcagggcggcaaggctcgcgccaaagccaagacccgttcttca
cgggccggcctgcagttcccggtgggtcgcgtgcaccgtctgctccgaaagggcagctac
tctgagcgcgtgggcgccggcgccccggtgtacctggcggccgtgatggagtacctgacg
gccgagatcctggagctggcgggcaacgctgcgagggacaacaagaagactcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaaactgctgggccgt
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggcggtgctgctgcccaagaag
acggagagctaccacaaggctaaggggaagtaa

KEGG   Rattus norvegicus (rat): 103690190
Entry
103690190         CDS       T01003                                 

Name
(RefSeq) histone H2A type 1-E
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103690190
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103690190
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    103690190
  09165 Substance dependence
   05034 Alcoholism
    103690190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    103690190
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    103690190
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    103690190
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103690190
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 103690190
NCBI-ProteinID: XP_008769993
RGD: 9087157
Ensembl: ENSRNOG00000060492
UniProt: P0C170 K7R8M0
Position
17
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgcggcaagcagggcggcaaggctcgcgccaaggcgaagacgcgctcttcc
cgagctggcctgcagttccccgtgggccgcgtgcaccggctgcttcgcaagggcaactac
gcggagcgggtgggagccggcgccccggtgtacctggcggccgtgctggagtacctgacg
gccgagatcttggagctcgcaggcaacgcggcgagggacaacaaaaagacacgcatcatt
ccgcgtcacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgactattgcgcagggtggcgtcctgcccaacatccaagccgtgctgctgcccaagaag
accgagagccaccacaaggccaaggggaaataa

KEGG   Rattus norvegicus (rat): 24828
Entry
24828             CDS       T01003                                 

Symbol
H2ac1
Name
(RefSeq) histone H2A type 4
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24828 (H2ac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    24828 (H2ac1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    24828 (H2ac1)
  09165 Substance dependence
   05034 Alcoholism
    24828 (H2ac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    24828 (H2ac1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24828 (H2ac1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    24828 (H2ac1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24828 (H2ac1)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 24828
NCBI-ProteinID: NP_068611
RGD: 3854
Ensembl: ENSRNOG00000048122
UniProt: Q00728
Position
17
AA seq 130 aa
MSGRAKQGGKARAKAKSRSFRAGLQFPVGRVHRLLRQGNYAERIGAGTPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKSQTK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggccgtgcaaagcagggtggcaaggctcgtgccaaggccaagtcccgctctttc
agagcaggtttgcagtttcctgtgggacgtgtgcaccggctccttcgccaagggaactac
gcagagcgaattggggctggcacaccagtgtacttggcggccgtgctggagtacctgacg
gctgagatcctggagctggcgggcaatgcggcgagggataacaagaagacgcgcattatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaataagctgctgggccgc
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
accgagagccaccacaagtcccagaccaagtga

KEGG   Rattus norvegicus (rat): 29384
Entry
29384             CDS       T01003                                 

Symbol
Macroh2a1
Name
(RefSeq) core histone macro-H2A.1
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    29384 (Macroh2a1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    29384 (Macroh2a1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    29384 (Macroh2a1)
  09165 Substance dependence
   05034 Alcoholism
    29384 (Macroh2a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    29384 (Macroh2a1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29384 (Macroh2a1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    29384 (Macroh2a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29384 (Macroh2a1)
SSDB
Motif
Pfam: Macro Histone_H2A_C Histone CBFD_NFYB_HMF DUF1764 Clp_N
Other DBs
NCBI-GeneID: 29384
NCBI-ProteinID: NP_058878
RGD: 621462
Ensembl: ENSRNOG00000011523
UniProt: Q02874
Structure
PDB: 
1YD9

Position
17
AA seq 371 aa
MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEI
LELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGS
KGKLEAIITPPPAKKAKSPSQKKPVAKKTGGKKGARKSKKQGEVSKAASADSTTEGAPTD
GFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGSTLEKKGGKEF
VEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALA
DDRKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGI
YVQEMAKLDAN
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgtcgagccgtggtgggaagaagaaatccaccaagacctcccggtcagccaaggccggg
gtcatcttccccgtgggacggatgctgcggtacatcaagaaaggccaccctaagtatcgg
atcggagtgggggcgcctgtgtacatggctgccgtactggaatacctgaccgctgagatc
ctggagctggccggcaatgcagcgagagacaacaagaaggggcgggtcacaccgcggcac
atcctgttagcagtggccaatgatgaggagctaaaccagctgctaaaaggagtcaccata
gccagtgggggcgtgttgccgaacatccatcctgagttgctagcgaagaaacgaggatcc
aagggaaaattggaagccatcatcacgcctccaccagccaaaaaggccaagtctccatcc
cagaagaagccagtggctaagaaaacaggaggcaagaaaggggcccggaagtctaagaag
cagggagaagtcagcaaggcagccagcgcagacagtacaacggagggcgcgcctacagac
ggctttactgtcctctctaccaagagcctcttcctcggccagaagctgaaccttattcac
agtgaaatcagtaatttagccggctttgaggtggaggccataatcaatcctaccaatgct
gacattgaccttaaagatgacctaggaagcacactggagaagaaaggtggcaaggagttt
gtagaagctgttctggaacttcggaaaaagaatgggcccttggaagtagctggagctgct
gttagtgcaggccacggcctgcctgccaagtttgtgatccactgtaacagtcctgtctgg
ggcgcagacaaatgtgaagaacttctagaaaagacggtgaaaaactgcctggctctagct
gatgacagaaagctgaagtccatcgccttcccgtctattggcagtggcaggaacgggttc
ccgaagcagacagccgcccaactcattctgaaggccatctccagctactttgtgtccact
atgtcgtcctccatcaaaactgtgtactttgtgctttttgacagtgagagcataggcatc
tacgtgcaggaaatggccaaactggatgccaactag

KEGG   Rattus norvegicus (rat): 302783
Entry
302783            CDS       T01003                                 

Symbol
H2ab3
Name
(RefSeq) H2A.B variant histone 3
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    302783 (H2ab3)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    302783 (H2ab3)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    302783 (H2ab3)
  09165 Substance dependence
   05034 Alcoholism
    302783 (H2ab3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    302783 (H2ab3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    302783 (H2ab3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    302783 (H2ab3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   302783 (H2ab3)
SSDB
Motif
Pfam: Histone
Other DBs
NCBI-GeneID: 302783
NCBI-ProteinID: NP_001100439
RGD: 1561666
Ensembl: ENSRNOG00000029736
UniProt: D4ACM0
Position
X
AA seq 116 aa
MPRTTENSLRGSSSRRRRRSRTSRAELIFAVSLVEQHLREGGHARRRLSETVPIFLAAIL
EFLTRRLLELAGNEAQRRGTQSRITPELLDLAVYSNTLLSELFQFITISRVAPAHH
NT seq 351 nt   +upstreamnt  +downstreamnt
atgcccaggaccacggagaacagtcttcgaggttcctcatctcgtcgccgccgtcgctcc
cgcacctcaagagccgagctgatctttgccgtgagcctggtggaacaacatctgagggaa
ggcggccatgcccggaggaggctgagtgaaacggtgcccattttcctggcagccatcctg
gagttcctcacccgcaggctgctggagctggcaggcaatgaagcccaacgaagaggtacc
cagagccgcatcactccggagctgctggacttggcagtctacagcaataccctgctcagc
gaattgttccaattcatcaccatctcacgggtggctccagctcatcactag

KEGG   Rattus norvegicus (rat): 306962
Entry
306962            CDS       T01003                                 

Symbol
Hist1h2ac
Name
(RefSeq) histone H2A type 1-B
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    306962 (Hist1h2ac)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    306962 (Hist1h2ac)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    306962 (Hist1h2ac)
  09165 Substance dependence
   05034 Alcoholism
    306962 (Hist1h2ac)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    306962 (Hist1h2ac)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    306962 (Hist1h2ac)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    306962 (Hist1h2ac)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   306962 (Hist1h2ac)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 306962
NCBI-ProteinID: XP_038952090
RGD: 1597155
Ensembl: ENSRNOG00000056411
Position
17
AA seq 134 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGKMCHI
NT seq 405 nt   +upstreamnt  +downstreamnt
atgtctggacgcggcaagcagggcggcaaggctcgcgccaaggccaagacccgctcctcc
cgggccggcctgcaattcccggtgggtcgcgtgcaccggctgctccgcaagggcaactac
tccgagcgggtgggcgccggcgccccagtgtatctggcggccgtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcggcgagggacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggcggtgtcctgcctaatatccaggcggtgctgctgcccaagaaa
acggaaagccaccacaaggccaagggaaaaatgtgccacatttga

KEGG   Rattus norvegicus (rat): 306970
Entry
306970            CDS       T01003                                 

Symbol
Hist1h2an
Name
(RefSeq) histone cluster 1, H2an
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    306970 (Hist1h2an)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    306970 (Hist1h2an)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    306970 (Hist1h2an)
  09165 Substance dependence
   05034 Alcoholism
    306970 (Hist1h2an)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    306970 (Hist1h2an)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    306970 (Hist1h2an)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    306970 (Hist1h2an)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   306970 (Hist1h2an)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 306970
NCBI-ProteinID: NP_001100824
RGD: 1309078
UniProt: G3V9C0
Position
17
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgcggcaagcagggcggcaaggctcgcgccaaggccaagacccgctcctcc
cgggccggcctgcaattcccggtgggccgagtgcatcgtctgctgcgcaagggtaattac
tcggagcgcgtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcggcgagagacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgatgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtactgctgcccaagaag
accgagagccaccataaggccaaggggaagtaa

KEGG   Rattus norvegicus (rat): 361844
Entry
361844            CDS       T01003                                 

Symbol
Macroh2a2
Name
(RefSeq) core histone macro-H2A.2
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    361844 (Macroh2a2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    361844 (Macroh2a2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    361844 (Macroh2a2)
  09165 Substance dependence
   05034 Alcoholism
    361844 (Macroh2a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    361844 (Macroh2a2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    361844 (Macroh2a2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    361844 (Macroh2a2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   361844 (Macroh2a2)
SSDB
Motif
Pfam: Macro Histone_H2A_C Histone CBFD_NFYB_HMF DUF1764 Clp_N
Other DBs
NCBI-GeneID: 361844
NCBI-ProteinID: NP_001129279
RGD: 1561371
Ensembl: ENSRNOG00000024751
UniProt: B1WC28
Position
20
AA seq 372 aa
MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEI
LELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGT
KGKSETILSPPPEKRGRKAASGKKGGKKSKATKPRTSKKSKAKDSDKEGTSNSTSEDGPG
DGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEEIGKALEKAGGKE
FLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSA
AEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSSSSLKNVYFLLFDSESIG
IYVQEMAKLDTK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtcaggccggagcgggaagaagaaaatgtctaagctgtctcggtcagccagggccggg
gtcatctttccagtagggcggttgatgcgctacctgaagaaaggaactttcaagtaccgg
atcagcgtgggtgctccagtctacatggctgcagtcattgagtacctggcagcggaaatc
ctagagttggctgggaacgctgcgagggacaacaagaaggcccggatagcccccagacac
atcctgctggccgttgccaacgatgaggagctcaaccagttgctgaaaggagtgaccatc
gccagtgggggtgtcttgcccagaattcaccccgaactgttggccaaaaagcgagggacc
aaaggcaagtcagaaaccatcctctccccacccccagagaaaagaggaaggaaggccgca
tcaggcaagaaggggggtaagaaatccaaggccactaagccgcggacgtccaagaagtcc
aaagccaaggacagcgataaagaaggaacatcgaattccacctcagaagacgggccgggg
gatggctttaccatcctgtcttcgaagagcctcgttctggggcagaagctgtccctgacc
cagagtgacatcagccacatcggctccatgagggtggagggcatcgtccacccaaccaca
gccgaaatcgacctcaaggaagagataggtaaagccttggaaaaggccgggggtaaagag
ttcttggaaacagtaaaggagcttcgcaagtcccaaggccctttggaagttgccgaagct
gccgtcagccaatccagtggactcgcagccaagtttgtcatccactgtcacatcccccag
tggggctccgacaaatgtgaagaacagctggaagagaccatcaaaaactgcctgtccgca
gccgaggacaagaagcttaaatctgtcgccttcccaccgttccccagtggcagaaactgc
tttcccaaacagacggccgcccaagtgaccctcaaggccatctcggcccacttcgacgac
tcgagctcatcctcgctgaagaatgtgtacttcctgctcttcgacagcgagagcattggc
atctacgtgcaggagatggccaaactggacaccaagtag

KEGG   Rattus norvegicus (rat): 365877
Entry
365877            CDS       T01003                                 

Symbol
Hist2h2aa3
Name
(RefSeq) histone H2A type 1
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    365877 (Hist2h2aa3)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    365877 (Hist2h2aa3)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    365877 (Hist2h2aa3)
  09165 Substance dependence
   05034 Alcoholism
    365877 (Hist2h2aa3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    365877 (Hist2h2aa3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    365877 (Hist2h2aa3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    365877 (Hist2h2aa3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   365877 (Hist2h2aa3)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 365877
NCBI-ProteinID: NP_001302422
RGD: 1307165
Ensembl: ENSRNOG00000052555
UniProt: P0CC09 K7S2S2
Position
2
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtccggccgtggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcggtcgtcc
cgcgccgggctgcagttcccagtgggtcgcgtgcaccggctgctgcgcaagggcaactac
gcggagcgcgtgggcgccggcgcgccggtatacatggcggcggtgctggagtacctgacc
gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacccgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaagaactcaacaagctgctgggcaaa
gtgacgatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
acggagagccaccataaggcgaagggcaagtga

KEGG   Rattus norvegicus (rat): 498753
Entry
498753            CDS       T01003                                 

Symbol
Hist1h2af
Name
(RefSeq) histone H2a
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    498753 (Hist1h2af)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    498753 (Hist1h2af)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    498753 (Hist1h2af)
  09165 Substance dependence
   05034 Alcoholism
    498753 (Hist1h2af)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    498753 (Hist1h2af)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    498753 (Hist1h2af)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    498753 (Hist1h2af)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   498753 (Hist1h2af)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 498753
NCBI-ProteinID: NP_001019453
RGD: 1564767
Ensembl: ENSRNOG00000022146
UniProt: Q6I8Q6
Position
17
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLYKGNYSERVGASAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKSKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgcggcaagcagggcggcaaggctcgggctaaggccaagacccgctcctcc
cgggccggcctgcagttccccgtgggccgcgtgcaccgtctgctttacaagggcaactac
tcggagagggtgggcgccagcgccccggtgtacttggcggctgtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcggcgagggacaacaaaaagacacgcatcatc
ccgcgccacctacagctggccattcgcaacgatgaggagctcaacaagctgctgggccgt
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggcagtgctgctgcccaaaaag
accgagagccaccacaagtccaaggggaaatag

KEGG   Rattus norvegicus (rat): 498894
Entry
498894            CDS       T01003                                 

Symbol
RGD1560813
Name
(RefSeq) histone H2A.V-like
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    498894 (RGD1560813)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    498894 (RGD1560813)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    498894 (RGD1560813)
  09165 Substance dependence
   05034 Alcoholism
    498894 (RGD1560813)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    498894 (RGD1560813)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    498894 (RGD1560813)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    498894 (RGD1560813)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   498894 (RGD1560813)
SSDB
Motif
Pfam: Histone Histone_H2A_C
Other DBs
NCBI-GeneID: 498894
NCBI-ProteinID: XP_003751869
RGD: 1560813
Position
18
AA seq 128 aa
MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGCIHRHLKTRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTA
NT seq 387 nt   +upstreamnt  +downstreamnt
atggctggaggcaaagctggaaaagacagcgggaaggccaaggctaaggcagtgtctcgc
tcacagagagctgggctccagtttcctgtgggctgcatccacagacacttgaagactcgc
accacaagccatggacgggtgggcgccactgctgctgtgtacagtgctgcaattctggag
tacctcacagctgaggtgttggagttggcaggtaatgcttctaaagatctcaaagtaaag
cgcatcaccccacgtcacttacagcttgcaatccgaggtgacgaagagttggattcactg
atcaaggctaccatagccgggggcggtgtgattccgcacatccacaagtctctgatcgga
aagaaggggcagcagaaaactgcttag

KEGG   Rattus norvegicus (rat): 499675
Entry
499675            CDS       T01003                                 

Symbol
H2ac20
Name
(RefSeq) histone H2A type 2-C
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    499675 (H2ac20)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    499675 (H2ac20)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    499675 (H2ac20)
  09165 Substance dependence
   05034 Alcoholism
    499675 (H2ac20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    499675 (H2ac20)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    499675 (H2ac20)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    499675 (H2ac20)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   499675 (H2ac20)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 499675
NCBI-ProteinID: XP_574997
RGD: 1560965
Ensembl: ENSRNOG00000030736
Position
2
AA seq 129 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHKAKSK
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtctggccgcggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcggtcgtcc
cgcgccgggctgcagttcccagtgggtcgcgtgcaccggctgctgcgcaagggcaactac
gcggagcgcgtgggcgccggcgcgccggtatacatggcagcggtgctggagtacctgacc
gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacccgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaagaactcaacaagctgctgggcaaa
gtgacgatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
actgagagccacaaggctaagagcaagtga

KEGG   Rattus norvegicus (rat): 500987
Entry
500987            CDS       T01003                                 

Symbol
H2ax
Name
(RefSeq) H2A.X variant histone
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    500987 (H2ax)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    500987 (H2ax)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    500987 (H2ax)
  09165 Substance dependence
   05034 Alcoholism
    500987 (H2ax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    500987 (H2ax)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    500987 (H2ax)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    500987 (H2ax)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   500987 (H2ax)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 500987
NCBI-ProteinID: NP_001102761
RGD: 1566119
Ensembl: ENSRNOG00000010386
UniProt: D3ZXP3
Position
8
AA seq 143 aa
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TSATVGPKAPAGGKKASQASQEY
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtcgggtcgcggcaagaccggcggcaaggcccgcgccaaagccaagtcgcgctcttcg
cgcgccggccttcagttcccggtaggccgcgtgcaccgactgctgcggaaaggccattac
gccgagcgcgtgggcgcaggcgcgcccgtgtacctggcggcggtgctcgagtacctcact
gccgagatcctggagctggcgggcaacgcggctcgggacaacaagaagacgcgcattatc
ccgcgccacctgcagctggctatccgcaacgacgaggagctcaacaagctgctgggcggc
gtgactatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
accagcgccaccgtggggcccaaggcgccggcgggcggcaagaaggcctcccaggcctct
caggagtactga

KEGG   Rattus norvegicus (rat): 502125
Entry
502125            CDS       T01003                                 

Symbol
Hist1h2ah
Name
(RefSeq) histone H2A type 1-E
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    502125 (Hist1h2ah)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    502125 (Hist1h2ah)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    502125 (Hist1h2ah)
  09165 Substance dependence
   05034 Alcoholism
    502125 (Hist1h2ah)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    502125 (Hist1h2ah)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    502125 (Hist1h2ah)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    502125 (Hist1h2ah)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   502125 (Hist1h2ah)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 502125
NCBI-ProteinID: NP_001302421
RGD: 1594367
Ensembl: ENSRNOG00000049649
UniProt: P0C170 K7R8M0
Position
17
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgcggcaaacaaggcggtaaggctcgcgccaaggccaagacccgctcctcc
cgggccggcctgcagttccccgtgggccgtgtgcaccgtttgcttcgcaaaggcaactac
gcggagagggtgggcgccggcgccccggtgtacctggcggctgtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcggcgagggacaacaagaagacacgcatcatc
ccgcgccacctacagctggccattcggaacgatgaggaactcaacaagctgctgggccgt
gtgaccatcgcccagggcggcgttctgcccaacatccaagcggtgctgctgcccaagaag
actgagagccaccacaaggccaagggcaaataa

KEGG   Rattus norvegicus (rat): 502129
Entry
502129            CDS       T01003                                 

Symbol
hist1h2ail2
Name
(RefSeq) histone H2A type 1-B
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    502129 (hist1h2ail2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    502129 (hist1h2ail2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    502129 (hist1h2ail2)
  09165 Substance dependence
   05034 Alcoholism
    502129 (hist1h2ail2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    502129 (hist1h2ail2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    502129 (hist1h2ail2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    502129 (hist1h2ail2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   502129 (hist1h2ail2)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 502129
NCBI-ProteinID: XP_577577
RGD: 1562827
Ensembl: ENSRNOG00000059748
UniProt: G3V9C0
Position
17
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgtgggaagcagggcggcaaggctcgcgccaaggccaagacccggtcctcc
cgggcgggcctgcagtttcccgtgggccgcgtgcaccgtctgctgcgtaagggcaactat
tcggagcgggtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcagcgagggacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcacagggcggcgttctgccaaacatccaggcggtgctgctgcccaagaag
accgagagccaccacaaggctaaggggaagtaa

KEGG   Rattus norvegicus (rat): 58940
Entry
58940             CDS       T01003                                 

Symbol
H2az1
Name
(RefSeq) histone H2A.Z
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    58940 (H2az1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    58940 (H2az1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    58940 (H2az1)
  09165 Substance dependence
   05034 Alcoholism
    58940 (H2az1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    58940 (H2az1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    58940 (H2az1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    58940 (H2az1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   58940 (H2az1)
SSDB
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 58940
NCBI-ProteinID: NP_073165
RGD: 621464
Ensembl: ENSRNOG00000010306
UniProt: P0C0S7
Position
2
AA seq 128 aa
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTV
NT seq 387 nt   +upstreamnt  +downstreamnt
atggctggcggtaaggctggaaaggactccggaaaggccaagacaaaggcggtttcccgc
tcccagcgagcgggcttgcagttccctgtgggccgtattcatcgacacctgaaatctagg
acaacaagccacggacgtgtgggcgcgaccgcagctgtgtacagcgcagccatcctggag
tacctcaccgcagaggtacttgagttggcaggaaatgcatcaaaagacttgaaggtaaag
cgtattacccctcgtcacttgcaacttgctatccgcggagatgaagagttggactctctg
atcaaggctacgattgctggtggtggtgtcatcccacacatccacaaatcactgattggg
aagaaaggacaacagaagactgtctaa

KEGG   Rattus norvegicus (rat): 64646
Entry
64646             CDS       T01003                                 

Symbol
Hist3h2a
Name
(RefSeq) histone H2A type 3
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    64646 (Hist3h2a)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    64646 (Hist3h2a)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    64646 (Hist3h2a)
  09165 Substance dependence
   05034 Alcoholism
    64646 (Hist3h2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    64646 (Hist3h2a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64646 (Hist3h2a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    64646 (Hist3h2a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64646 (Hist3h2a)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 64646
NCBI-ProteinID: NP_068612
RGD: 621437
UniProt: Q4FZT6
Position
10
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggtcgtggcaagcagggcggcaaagctcgtgcaaaagcgaagtctcgctcatcc
cgcgctggcctgcagtttccagtgggccgtgtgcaccgccttctccgtaagggcaactac
tcggagcgggtgggcgccggcgctccggtgtacctagcggctgtgctggaatacctgact
gctgagatcctggagctggctgggaatgcggcccgcgataataagaagacgcggattatc
ccgcgccacctgcagttggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggcggtgttgctgcccaagaag
acggagagccaccacaaggccaagggcaagtga

KEGG   Rattus norvegicus (rat): 680322
Entry
680322            CDS       T01003                                 

Symbol
H2ac12
Name
(RefSeq) histone H2A type 1-H
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    680322 (H2ac12)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    680322 (H2ac12)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    680322 (H2ac12)
  09165 Substance dependence
   05034 Alcoholism
    680322 (H2ac12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680322 (H2ac12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    680322 (H2ac12)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    680322 (H2ac12)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   680322 (H2ac12)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 680322
NCBI-ProteinID: XP_008769989
RGD: 1593006
Position
17
AA seq 168 aa
MLTNDGSPFSRLGLTIKIKSVFLLHVFVASVKGKRDKFFIMSGRGKQGSKARAKAKTRSF
RAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKVK
NT seq 507 nt   +upstreamnt  +downstreamnt
atgctaaccaatgacgggtctcctttttcgcgccttggcttaactataaaaatcaagagc
gtgttccttcttcatgtttttgtagcgagcgttaaaggcaagagggacaagttctttatt
atgtctggacgcggcaagcagggcagcaaggctcgcgccaaggccaagacccgctccttc
cgggccggcctgcaattcccggtgggtcgcgtgcaccggctgctccgcaagggcaactac
tccgagcgggtgggcgccggcgccccagtgtatctggcggccgtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcggcgagggacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggcggtgctgctgcccaagaag
acggagagccaccacaaggttaagtga

KEGG   Rattus norvegicus (rat): 680615
Entry
680615            CDS       T01003                                 

Symbol
Hist1h2ak
Name
(RefSeq) histone cluster 1, H2ak
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    680615 (Hist1h2ak)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    680615 (Hist1h2ak)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    680615 (Hist1h2ak)
  09165 Substance dependence
   05034 Alcoholism
    680615 (Hist1h2ak)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680615 (Hist1h2ak)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    680615 (Hist1h2ak)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    680615 (Hist1h2ak)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   680615 (Hist1h2ak)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 680615
NCBI-ProteinID: NP_001102893
RGD: 1589461
Ensembl: ENSRNOG00000052594
UniProt: D3ZVK7
Position
17
AA seq 130 aa
MTGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgactggacgtggtaaacaaggtggtaaggctcgtgccaaggccaagacccgctcctcc
cgggccggcctacagttccccgtgggtcgtgtgcaccgtctgctccgcaagggcaactac
tcggaacgggtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg
gccgagatcttggagctggcgggcaacgcggcgagggacaacaagaagacgcgtatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcacagggcggtgtcctgcccaacatccaggcggtgctgctgcccaagaag
accgagagccaccacaaagctaagggaaagtga

KEGG   Rattus norvegicus (rat): 684773
Entry
684773            CDS       T01003                                 

Name
(RefSeq) histone H2A type 1-B
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    684773
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    684773
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    684773
  09165 Substance dependence
   05034 Alcoholism
    684773
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    684773
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    684773
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    684773
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   684773
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 684773
NCBI-ProteinID: XP_008769901
RGD: 1586722
Position
17
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgcggcaagcagggcggcaaggctcgcgccaaggccaagacccgctcctcc
cgggccggcctgcaattcccggtgggccgagtgcatcgtctgctgcgcaagggtaattac
tcggagcgcgtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcggcgagagacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgatgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtactgctgcccaagaag
accgagagccaccataaggccaaggggaagtaa

KEGG   Rattus norvegicus (rat): 685069
Entry
685069            CDS       T01003                                 

Name
(RefSeq) histone H2A.V-like
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    685069
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    685069
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    685069
  09165 Substance dependence
   05034 Alcoholism
    685069
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    685069
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    685069
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    685069
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   685069
SSDB
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 685069
NCBI-ProteinID: XP_006237271
RGD: 1583233
Ensembl: ENSRNOG00000037266
Position
4
AA seq 128 aa
MAGGKAGKDSRKAKAKAVSRSQRAGLQFPVDRIHRHVKTHTTSHGRVGAPAAVYSAAILE
YLTAEVLDLAGNASKDLKGKRITPRHLQLAIRGDEELDSLINATVAGGGVLPHIHKPLIG
KKGQQKTA
NT seq 387 nt   +upstreamnt  +downstreamnt
atggcaggaggcaaagctggaaaagacagccggaaggccaaggctaaggcagtgtctcgc
tcacagagagctgggctccagtttcctgtggaccgcatccacagacacgtgaagactcac
accacaagccatggacgggtgggcgcccctgctgctgtgtacagtgctgcaattctggag
tacctcacagccgaggtgttggacttggcaggtaacgcttctaaagatctcaaaggaaag
cgcatcaccccacgccacttacagcttgcaatccgaggtgacgaagagttggattcactg
atcaatgctaccgtagccgggggcggtgtgcttccacacatccacaagcctctgatcgga
aagaaggggcagcagaaaactgcttag

KEGG   Rattus norvegicus (rat): 685909
Entry
685909            CDS       T01003                                 

Symbol
H2az2
Name
(RefSeq) H2A.Z variant histone 2
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    685909 (H2az2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    685909 (H2az2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    685909 (H2az2)
  09165 Substance dependence
   05034 Alcoholism
    685909 (H2az2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    685909 (H2az2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    685909 (H2az2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    685909 (H2az2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   685909 (H2az2)
SSDB
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 685909
NCBI-ProteinID: NP_001099489
RGD: 1587865
Ensembl: ENSRNOG00000052275
UniProt: D4AEC0
Position
14
AA seq 128 aa
MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTA
NT seq 387 nt   +upstreamnt  +downstreamnt
atggctggaggcaaagctggaaaagacagcgggaaggccaaggctaaggcagtgtctcgc
tcacagagagctgggctccagtttcctgtgggccgcatccacagacacttgaagactcgc
accacaagccatggacgggtgggcgccactgctgctgtgtacagtgctgcaattctggag
tacctcacagctgaggtgttggagttggcaggtaatgcttctaaagatctcaaagtaaag
cgcatcaccccacgtcacttacagcttgcaatccgaggtgacgaagagttggattcactg
atcaaggctaccatagccgggggcggtgtgattccgcacatccacaagtctctgatcgga
aagaaggggcagcagaaaactgcttag

KEGG   Rattus norvegicus (rat): 689408
Entry
689408            CDS       T01003                                 

Name
(RefSeq) histone H2A.V-like
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    689408
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    689408
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    689408
  09165 Substance dependence
   05034 Alcoholism
    689408
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    689408
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    689408
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    689408
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   689408
SSDB
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 689408
NCBI-ProteinID: XP_001070681
RGD: 1592352
Ensembl: ENSRNOG00000038771
Position
6
AA seq 157 aa
MRSGSSCGGPTARAAVAVQGYSGRCAAETMAGGKAGKDNGKAKAKAVSRSQRAGLQFPVG
RIHRHLKTRATSRGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPSHLQLAI
RGDEELDSLINATIAGGGVIPHIHKSLIGKKGQQKTA
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaggtccggctccagctgcggcggtccgactgcgagagcagcggtggcggtgcagggc
tacagtgggcgttgcgcggccgagaccatggctggaggcaaagctggaaaagacaacggg
aaggccaaggctaaggcagtgtcacgctcacagagagctgggctccagtttcctgtgggc
cgcatccacagacacttgaagactcgcgccacaagccgtggacgggtgggcgccactgct
gctgtgtacagtgctgcaattctggagtacctcacagctgaggtgttggagttggcaggt
aatgcttctaaagatctcaaagtaaagcgcatcaccccaagtcacttacagcttgcaatc
cgaggtgacgaagagttggattcactgatcaatgctaccatagccgggggcggtgtgatt
ccgcacatccacaagtctctgatcggaaagaaggggcagcagaaaactgcttag

KEGG   Rattus norvegicus (rat): 690102
Entry
690102            CDS       T01003                                 

Symbol
H2ac21
Name
(RefSeq) H2A clustered histone 21
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    690102 (H2ac21)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    690102 (H2ac21)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    690102 (H2ac21)
  09165 Substance dependence
   05034 Alcoholism
    690102 (H2ac21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    690102 (H2ac21)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    690102 (H2ac21)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    690102 (H2ac21)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   690102 (H2ac21)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 690102
NCBI-ProteinID: NP_001104811
RGD: 1584064
Ensembl: ENSRNOG00000048317
UniProt: D3ZWE0
Position
2
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TDSHKPGKNK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtccggccgcggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcggtcgtcc
cgcgccgggctgcagttcccagtgggtcgcgtgcaccggctgctgcgcaagggcaactac
gcggagcgcgtgggcgccggcgcgccggtgtacatggcggcggtgctggagtacctgacc
gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacccgcatcatc
ccgcgccacctacagctagctgtaaggaacgatgaagagctcaacaagttactaggagga
gtcaccattgcccagggtggggtcctccccaatatccaggctgtcttactaccgaagaaa
acggatagtcataagcctggaaagaacaaataa

KEGG   Rattus norvegicus (rat): 690131
Entry
690131            CDS       T01003                                 

Symbol
Hist2h2aa2
Name
(RefSeq) histone H2A type 2-A
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    690131 (Hist2h2aa2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    690131 (Hist2h2aa2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    690131 (Hist2h2aa2)
  09165 Substance dependence
   05034 Alcoholism
    690131 (Hist2h2aa2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    690131 (Hist2h2aa2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    690131 (Hist2h2aa2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    690131 (Hist2h2aa2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   690131 (Hist2h2aa2)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 690131
NCBI-ProteinID: XP_003749398
RGD: 1584037
Ensembl: ENSRNOG00000047898
UniProt: P0CC09 K7S2S2
Position
2
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtccggccgtggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcggtcgtcc
cgcgccgggctgcagttcccagtgggtcgcgtgcaccggctgctgcgcaagggcaactac
gcggagcgcgtgggcgccggcgcgccggtatacatggcggcggtgctggagtacctgacc
gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacccgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaagaactcaacaagctgctgggcaaa
gtgacgatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
acggagagccaccataaggcgaagggcaagtga

KEGG   Rattus norvegicus (rat): 690795
Entry
690795            CDS       T01003                                 

Symbol
H2aj
Name
(RefSeq) histone H2A.J
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    690795 (H2aj)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    690795 (H2aj)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    690795 (H2aj)
  09165 Substance dependence
   05034 Alcoholism
    690795 (H2aj)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    690795 (H2aj)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    690795 (H2aj)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    690795 (H2aj)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   690795 (H2aj)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 690795
NCBI-ProteinID: NP_001103080
RGD: 1592176
Ensembl: ENSRNOG00000033045
UniProt: A9UMV8
Position
4
AA seq 129 aa
MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESQKVKSK
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtccgggcgaggcaagcaggggggtaaggtgcgggccaaggccaagtcgcgctcgtcg
cgcgcgggcctccagttccccgtgggccgtgttcaccggctgctgcgcaagggcaactac
gcggagcgcgtgggcgcgggagcgcccgtgtacctggcggcggtgctggagtacctgacg
gccgagatcctggaactggcgggcaacgcggcgagggacaacaagaagacgcgcatcatc
cctcgccacctgcagctggctatccgcaacgacgaagagctcaacaagcttctgggccgt
gtgaccatcgcgcagggcggtgtcctgcccaacatccaggccgtgctgctgcccaagaag
acggagagccagaaggtgaagagcaagtga

DBGET integrated database retrieval system