KEGG   Rattus norvegicus (rat): 100360880
Entry
100360880         CDS       T01003                                 

Symbol
Fosb
Name
(RefSeq) protein fosB
  KO
K09029  protein FosB
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04380  Osteoclast differentiation
rno04657  IL-17 signaling pathway
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100360880 (Fosb)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100360880 (Fosb)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    100360880 (Fosb)
   05031 Amphetamine addiction
    100360880 (Fosb)
   05034 Alcoholism
    100360880 (Fosb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    100360880 (Fosb)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100360880 (Fosb)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ASD2 DUF4407 DivIC DUF3450 FapA Spc24
Other DBs
NCBI-GeneID: 100360880
NCBI-ProteinID: NP_001243438
RGD: 1308198
Ensembl: ENSRNOG00000046667
UniProt: D3ZLB7
Position
1
AA seq 338 aa
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPAVDPYDMPGTSYSTPGLSAYSTGGASGS
GGPSTSTSTSGPVSARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
LPGSTSAKEDGFGWLLPPPPPPPLPFQSSRDAPPNLTASLFTHSEVQVLGDPFPVVSPSY
TSSFVLTCPEVSAFAGSQRTSGSEQPSDPLNSPSLLAL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgtttcaagctttccccggagactacgactccggctcccggtgtagctcatcaccctcc
gccgagtctcagtacctgtcttcggtggactccttcggcagtccacccaccgccgccgcc
tcccaggagtgcgccggtctcggggaaatgcccggctccttcgtgccaacggtcaccgca
atcacaaccagccaggaccttcagtggctcgtgcagcccaccctcatctcttccatggcc
cagtcccaggggcagccactggcctcccagcctccagctgttgacccttatgacatgcct
ggaaccagctactcaaccccgggcctgagtgcctacagcactggtggggcaagcggaagt
ggtgggccttcaactagcacaagcaccagtggacccgtgtctgcccgcccagccagagcc
aggcctagaagaccccgagaagaaacacttaccccagaagaagaagaaaaacgaagggtt
cgcagagagcggaacaagctggctgcagctaaatgcagaaaccgtcggagggagctgaca
gaccgactccaggcggaaacggatcagctcgaagaggaaaaggcagagctggagtcggag
atcgccgagctgcaaaaagagaaggaacgcctggagtttgtcctggtggcccacaaaccg
ggctgcaagatcccttacgaagaggggccggggccaggcccgctggccgaggtgagagat
ttgccagggtcaacatccgctaaggaagacggcttcggctggctgctgccgccccctcca
ccaccgcccctgcccttccagagcagccgagacgcaccccccaacctgacggcttctctc
tttacacacagtgaagttcaagtcctcggcgaccccttccccgttgttagcccttcgtac
acttcctcgtttgtcctcacctgcccggaggtctccgcgttcgccggctcccaacgcacc
agcggcagcgagcagccgtccgaccccctgaactcgccctcccttcttgctctgtaa

DBGET integrated database retrieval system