KEGG   Rattus norvegicus (rat): 100360936
Entry
100360936         CDS       T01003                                 

Symbol
Anapc16
Name
(RefSeq) anaphase-promoting complex subunit 16 isoform X1
  KO
K25229  anaphase-promoting complex subunit 16
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100360936 (Anapc16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100360936 (Anapc16)
   04114 Oocyte meiosis
    100360936 (Anapc16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100360936 (Anapc16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100360936 (Anapc16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    100360936 (Anapc16)
   03036 Chromosome and associated proteins [BR:rno03036]
    100360936 (Anapc16)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100360936 (Anapc16)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100360936 (Anapc16)
SSDB
Motif
Pfam: ANAPC16
Other DBs
NCBI-GeneID: 100360936
NCBI-ProteinID: XP_006256496
RGD: 2321124
Ensembl: ENSRNOG00000000576
UniProt: D3ZDN9
Position
20
AA seq 129 aa
MSARSSLSYTNEERLLLEGMAASSSSSSAGGVSGSSVPGSGFSVSDLAPPRKALFTYPKG
AGEILEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQ
LLGFTPSSG
NT seq 390 nt   +upstreamnt  +downstreamnt
atgagtgcgaggtcgtccctgtcgtatacaaatgaagagagacttctactggagggaatg
gccgcctcctcatcctcatcttcagctggtggggtcagtggaagttctgtccctggatct
ggtttcagtgtgtccgaccttgccccaccacggaaagctctgttcacctacccgaaagga
gctggagagatactagaagatggctctgagcgattcctctgtgagtcggtgtttagctat
caagtggcatccacacttaaacaggtgaaacatgatcagcaagtcgctcggatggaaaaa
ctggctggtttggtggaagagctggaggctgatgagtggcggtttaaacccatcgagcag
ctgctggggttcacaccctcctcgggttga

KEGG   Rattus norvegicus (rat): 288671
Entry
288671            CDS       T01003                                 

Symbol
Anapc5
Name
(RefSeq) anaphase-promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04657  IL-17 signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    288671 (Anapc5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    288671 (Anapc5)
   04114 Oocyte meiosis
    288671 (Anapc5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    288671 (Anapc5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    288671 (Anapc5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    288671 (Anapc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    288671 (Anapc5)
   03036 Chromosome and associated proteins [BR:rno03036]
    288671 (Anapc5)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     288671 (Anapc5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    288671 (Anapc5)
SSDB
Motif
Pfam: ANAPC5 TPR_12 TPR_10 TPR_2 TPR_7 YycI
Other DBs
NCBI-GeneID: 288671
NCBI-ProteinID: NP_001073616
RGD: 1306125
Ensembl: ENSRNOG00000001316
UniProt: A1L1K3
Position
12
AA seq 727 aa
MMTNGVVHANLFGIKDWVTPYKIAVLVLLNEMGRTGEGAVSLVERRKLNQLLLPLLQGPD
ITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDLEQFFDDLSDSFSGTEPEVHKTSVV
GLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMDREDGERQMEKEELDVS
VREEEVSCSGPLSQKQAEFFLSQQAALLKNDETKALTPASLQKELNNLLKFNPDFAEAHY
LSYLNNLRVQDVFSSTHSLLHYFDRLILTGAEGKSNGEEGYGRSLRYAALNLAALHCRFG
HYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRADSYVLLEHSVKKAVHFGLPR
AFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSM
NSLESLSAGVQQNNTESFAVALCHLAELHAEQGCFAAAGEVLKHLKERFPPNSQHAQLWM
LCDQKIQFDRAMNDGKFHLADSLVTGITALNGIEGVYRKAVVLQAQNQMTEAHKLLQKLL
TYCQKLKNTEMVISVLLSVAELYWRSSSPTIAMPVLLEALALSKEYRLQYLASETVLNLA
YAQLILGIPEQALTLLHMAIEPILADGAILDKGRAMFLVSKCQVASAASYDPVKKAEALE
AAIQNLTEAKNYFAKVDCRERIRDVSYFQARLYHALGKTQERNHCAMVFRQLHQELPSHG
VPLINHL
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgatgaccaacggggtagtgcacgccaacttgtttggcatcaaggactgggtgacgccc
tataagatcgcggtcctggtgctgctgaacgagatgggccgcacgggagagggtgctgtc
agccttgtggagcggcggaagctcaaccagctgctcctgcccctgctgcagggcccagat
attacactgtcaaagctgtacaaactaattgaagaatcgtgtcctcagctggcaaattca
gtgcagatcagaatcaaactgatggctgaaggcgaattgaaggatctggaacaatttttt
gatgacctttcagattctttttctggaactgaaccagaggttcacaaaacaagtgtagta
ggtctgtttctgcgtcacatgatcttggcctacagcaagctttccttcagtcaagtgttc
aagctgtacactgccctgcagcagtatttccagaacggggagaaaaagacggtggaagac
gctgacatggacagagaggatggagagagacagatggagaaggaggagctcgacgtatct
gtcagagaagaggaggtatcttgcagtggtcctctgtcccaaaaacaagcagaatttttt
ctttctcagcaggctgctttgttgaagaatgacgagactaaagccctcaccccagcctcc
ttgcagaaggagttgaacaacctgttgaaatttaatcctgattttgctgaagctcattac
ctcagctacttaaacaacctccgtgttcaagatgttttcagctcaacgcacagcctcctt
cattattttgaccgcctgattctcactggagcagagggcaaaagtaatggggaagaaggt
tatggccggagcctaagatacgccgctctcaacctggctgccctgcactgccgcttcggc
cactatcaacaggcagagctcgccctgcaggaggcaattaggattgcccaggagtccaac
gatcacgtgtgtctgcagcactgtttgagctggctttatgtgctggggcagaagagagcc
gatagctatgttctgctggagcattctgtgaagaaagcagtgcattttgggttaccgaga
gcttttgctgggaagacggccaacaaactgatggatgccctaaaggactctgacctcctg
cactggaaacacagcttgtcagaacttatcgacatcagcatcgcacagaaaacggccatc
tggaggctgtacggccgcagcaccatggcactgcagcaagcccagatgctgctgagcatg
aacagcctggagtcactgagtgcaggtgtgcaacagaacaacaccgagtcctttgccgtc
gctctctgccatcttgcagagctgcatgcagaacagggctgtttcgctgctgccggggaa
gtactgaagcacttgaaggaacggttcccacccaacagtcagcacgcccagttatggatg
ctgtgtgatcaaaaaatacagtttgacagagcaatgaatgatggtaaattccatttggct
gactcgcttgttacaggaatcacagcacttaatggcatagaaggagtatacagaaaagca
gtggtgctgcaagctcaaaaccagatgacagaggcacacaagcttttgcagaagttgctg
acatactgtcagaagttgaagaacacagagatggtcatcagcgtcctcctgtcggtggca
gagctgtactggcgatcttcctccccgaccatcgcaatgcctgtgctcctggaagctctg
gccctctccaaagaataccggttacagtacttggcctctgaaactgtgctcaacttggct
tatgcccagctcatcctggggatcccagaacaggccttaacccttctccacatggctatt
gagcccatcctggccgatggggccatcctggacaaaggccgtgccatgttcttagtgtcc
aagtgccaagtggcttcagcagcttcctatgacccagtgaagaaagcagaagctctggaa
gcagccattcagaacctcactgaagccaagaactactttgcaaaagtcgactgtagagag
cgcatcagggatgtgtcgtacttccaggccaggctgtaccacgccctcggcaagacccag
gagaggaaccactgtgccatggtcttccggcagctgcaccaggagctgccttcccatggg
gtgcccctgattaaccatctctag

KEGG   Rattus norvegicus (rat): 290875
Entry
290875            CDS       T01003                                 

Symbol
Cdc16
Name
(RefSeq) cell division cycle protein 16 homolog
  KO
K03353  anaphase-promoting complex subunit 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    290875 (Cdc16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    290875 (Cdc16)
   04114 Oocyte meiosis
    290875 (Cdc16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    290875 (Cdc16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    290875 (Cdc16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    290875 (Cdc16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    290875 (Cdc16)
   03036 Chromosome and associated proteins [BR:rno03036]
    290875 (Cdc16)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     290875 (Cdc16)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     290875 (Cdc16)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    290875 (Cdc16)
SSDB
Motif
Pfam: ANAPC3 TPR_2 TPR_1 TPR_12 TPR_7 TPR_8 TPR_10 TPR_19 TPR_11 TPR_9 SRP_TPR_like Foie-gras_1 Dynein_light
Other DBs
NCBI-GeneID: 290875
NCBI-ProteinID: NP_001019915
RGD: 1305076
Ensembl: ENSRNOG00000017536
UniProt: Q4V884
Position
16
AA seq 620 aa
MNLEPLRKRVRQYLDQQQYQSALFWADKVASLSHEEPQDVYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHYAAKEYQQALDILDMEEPINRRLFEKYLKDDSGSKDPSSD
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLDSLPLSKLCAEEQELLRFVFENKLKKYNKPSETVIPQSVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSAVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFGQALSIAPEDPFVIHEVGVVAFQNGEWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFRDFEVEKQNTEEAGLAPLENATKTPESRPSLEETF
EIEMNESDMMLETSMSDHST
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaacctggagccgctgcgcaaacgcgtccggcagtacctggaccagcaacagtatcaa
agtgctctgttttgggcagacaaggtagcttcactctctcatgaggaaccccaggatgtt
tattggttggctcagtgtctttacctcacagcacagtaccacagagcagcccatgcactc
cggtcacgcaagctggacaaactgtatgaagcttgccgataccttgcagctagatgccac
tatgctgcgaaagagtaccagcaggctctagacatccttgatatggaggaaccaattaac
agaaggctctttgagaagtacctgaaggatgacagtggctccaaagacccttccagtgac
tgggagatgtcacagtcctccataaagagctcgatttgtcttctgagggggaaaatctac
gatgcattagataatcgcaccctggctacctacagttacaaagaggctttgaagctcgac
gtctactgctttgaagcatttgatcttctgacgtcacaccacatgttgacagcacaggaa
gaaaaagaacttctagactcactgcctcttagcaagctctgtgccgaagaacaagaattg
ctacgatttgtatttgagaacaaattaaagaagtataataagcccagtgagactgtcatt
ccccagtcagtggacggcttgcaagagaatctggatgtggtagtgtctttggctgagaga
cactattataactgtgattttaagatgtgctacaagcttacgtctgcagtgatggaaaag
gaccctttccatgcaaactgtttacctgtgcacataggaactcttgtggagttgaataaa
gcaaatgaacttttctatctttctcacaaattggtggatttatatccgagtaatcctgtg
tcgtggttcgcggtgggctgctactacctcatggttggccataaaaacgagcacgccagg
agatacctcagcaaagctaccacactggagaagacctatgggcccgcctggatagcctac
gggcactccttcgctgtggagagcgagcatgaccaagccatggctgcttatttcacagcc
gcacagctcatgaaggggtgtcacttgccaatgctgtatattgggttagaatatggtttg
accaataactctaaactggctgagcggttctttggccaagctctgagcattgccccggaa
gacccgtttgtcatccatgaggttggagtggttgcctttcagaatggagaatggaaaaca
gcagaaaagtggtttctcgatgctttggaaaaaattaaagcaattgggaatgaggtaaca
gttgacaaatgggaacctttattgaacaacctggggcatgtctgcagaaaactcaagaag
tacgccgaggctctggattaccacaggcaggcactggtgctgatccctcagaatgcgtcc
acatactctgctataggctacatccacagtctgatgggcaacttcgaaaacgctgtggac
tatttccatacagctctcggtcttaggcgagacgacacgttttctgttacaatgcttggt
cattgcattgaaatgtacattggagattccgaagcttatatcggagcagacattaaagac
aaactaaagtgctatgactttgacgtgcatacaatgaaaacactaaaaaacatcatttcg
cctccgtgggatttcagggactttgaagtagaaaagcagaacacagaggaagccgggctt
gcacctctggaaaacgccactaaaaccccggagtccagaccttccttggaagagactttt
gaaattgaaatgaacgaaagtgacatgatgctagagacatctatgtcagaccacagcaca
tag

KEGG   Rattus norvegicus (rat): 291689
Entry
291689            CDS       T01003                                 

Symbol
Cdc23
Name
(RefSeq) cell division cycle protein 23 homolog
  KO
K03355  anaphase-promoting complex subunit 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    291689 (Cdc23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    291689 (Cdc23)
   04114 Oocyte meiosis
    291689 (Cdc23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    291689 (Cdc23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    291689 (Cdc23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    291689 (Cdc23)
   03036 Chromosome and associated proteins [BR:rno03036]
    291689 (Cdc23)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     291689 (Cdc23)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    291689 (Cdc23)
SSDB
Motif
Pfam: TPR_1 ANAPC8 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_16 TPR_17 ANAPC3 TPR_12 TPR_9 DUF772 TPR_15 TPR-S
Other DBs
NCBI-GeneID: 291689
NCBI-ProteinID: NP_001094129
RGD: 1304819
Ensembl: ENSRNOG00000024241
Position
18
AA seq 597 aa
MAANSSVVSVAAAATTVPGVSTVADFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLSELQPPPPLTEEDAQDVDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSRKHQARGLDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQHLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGETVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTSDTPGTFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggctgcgaattcttcggtagtctcggtggcagcggccgccacgacggtgccgggcgtg
tccactgtcgcggatttctcagacttgcgggaaattaaaaagcagctgctgctcatcgcg
ggcctcactcgggagcggggcctgctgcacagcagcaaatggtctgcggagttggccttc
tctctgcccgccttgcctttgtctgagctgcagccgccgccgcctcttacagaggaggat
gcacaggatgtggatgcttacaccctggccaaggcctactttgacgttaaagagtatgac
cgggcagcacatttcctgcatggctgtaatagcaagaaagcctatttcctgtacatgtat
tccagatacctgtctggagagaagaagaaggatgacgaaacagtcgatagcctaggaccc
ctagaaaaaggacaagtcaaaaacgaggctctccgagaactgagagtggaactcagcagg
aagcaccaagctaggggacttgatgggttcggcctttacctgtatggggtggtgcttcgg
aaactggacttagtgaaagaggctattgatgtgtttgtggaggctactcatgttctgccc
ttgcactggggggcctggttggagctgtgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgcctgacacctggatgaaggagttcttcttggctcacatatacacagaa
ttgcagctgatagaggaggccttgcagaagtaccagcatctcattgacgtgggcttttcc
aagagctcatacattgtttcccaaatcgcagttgcctatcacaatatcagagatatcgac
aaagccctttctattttcaatgagctgaggaaacaagatccttacaggattgaaaatatg
gacacgttctccaaccttctctatgtcaggagcatgaagtctgaattgagttacctggca
cataacctctgtgaaattgataagtaccgagtagagacatgctgtgtaattggcaattat
tacagcttacgctcccagcatgagaaagcagcgttgtatttccagagagccctgaaattg
aatcctaggtaccttggggcctggacgctgatggggcatgagtacatggaaatgaaaaac
acatctgcggctattcaggcttaccgacatgccattgaggtcaacaagagagactacaga
gcttggtatggccttgggcagacctacgaaatccttaagatgccattttattgcctttat
tattatagacgggcccaccagcttcggcccaacgattctcgtatgctggttgccttagga
gaatgttatgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcatac
gctgtgggagatgtggagaaaatggctctggtgaagctggccaagcttcatgaacagttg
actgagtcagagcaggctgcccagtgttacatcaaatacatccaagatatctattcctgt
ggggaaacagtggagcacttagaggagagcacagccttccgctacctggcccagtactat
tttaaatgcaagctgtgggatgaagcttcaacttgtgcccaaaaatgttgtgcattcaat
gatacccgggaagaaggtaaggccttgctccgccagatcctacagctgaggaaccaaggg
gagacacccacctctgacacgcctggtacctttttcctccctgcctcactgtctgcaaac
aacactcccacacgcagagtttctccactcaacttgtcttcagtcacaccatag

KEGG   Rattus norvegicus (rat): 293155
Entry
293155            CDS       T01003                                 

Symbol
Anapc15
Name
(RefSeq) anaphase-promoting complex subunit 15
  KO
K25228  anaphase-promoting complex subunit 15
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    293155 (Anapc15)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    293155 (Anapc15)
   04114 Oocyte meiosis
    293155 (Anapc15)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    293155 (Anapc15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    293155 (Anapc15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    293155 (Anapc15)
   03036 Chromosome and associated proteins [BR:rno03036]
    293155 (Anapc15)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     293155 (Anapc15)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    293155 (Anapc15)
SSDB
Motif
Pfam: ANAPC15 RNA_pol_Rpc4 DUF4746 DUF2457 Astro_capsid_p V_ATPase_I
Other DBs
NCBI-GeneID: 293155
NCBI-ProteinID: NP_001163906
RGD: 1311634
Ensembl: ENSRNOG00000019936
UniProt: D3ZQX4
Position
1
AA seq 132 aa
MEPGLKLSLGAMSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDN
NLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDM
EGNEQDQDQWMI
NT seq 399 nt   +upstreamnt  +downstreamnt
atggagccaggactcaaactcagcttaggagccatgtccaccttgttcccttcactcttt
cctcgtgtgactgagacactgtggtttaatctggatcgaccctgtgtggaggagacagag
ctgcagcagcaggagcagcagcatcaggcctggctccaaagcatcgcagagaaagacaac
aacctggtacccatcggcaagcctgcctccgagcactatgatgacgaggaagaagaggat
gatgaagatgacgaggacagtgaagaggattcagaagacgatgaggacatgcaggacatg
gatgagatgaatgactataatgagtcacctgatgatggagaggtcaatgaggtggacatg
gaaggcaacgaacaggatcaggaccagtggatgatctag

KEGG   Rattus norvegicus (rat): 296558
Entry
296558            CDS       T01003                                 

Symbol
Anapc2
Name
(RefSeq) anaphase-promoting complex subunit 2
  KO
K03349  anaphase-promoting complex subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    296558 (Anapc2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    296558 (Anapc2)
   04114 Oocyte meiosis
    296558 (Anapc2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    296558 (Anapc2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    296558 (Anapc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    296558 (Anapc2)
   03036 Chromosome and associated proteins [BR:rno03036]
    296558 (Anapc2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Cullin
     296558 (Anapc2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    296558 (Anapc2)
SSDB
Motif
Pfam: Cullin ANAPC2
Other DBs
NCBI-GeneID: 296558
NCBI-ProteinID: NP_001094002
RGD: 1305546
Ensembl: ENSRNOG00000011295
UniProt: B2RYJ1
Position
3
AA seq 836 aa
MEAEGVAVSVAAAAAATTTIVATDDCDSRPGQELVVAWNTVSTGLVPPAALGLASSRTSG
AVPPKEEELRAAVEVLRAHGLHSVLEEWFVEVLQNDLQGNIATEFWNAISLRENSVDEPQ
CLVLLLDAFGLLESRLDPYLHSLELLEKWTRLGLLMGAGAQGLREKVHTMLRGVLFFSTP
RTFQEMVQRLYGRFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCGS
DKQQCWCRQALEQFNQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFL
REFHKWIERVVGWLGKVFLQDNPSRPTSPEAGNTLRRWRCHVQRFFYRIYASLRIEELFS
IIRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKVALETRLLHPGVNTCDIITLYISAIKA
LRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPACLET
GQDSEDDSGEPEDWVPDPVDADPAKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADR
LLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPVEEQ
PPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALDVYCKKYEKLKAMRTLSWKHTLGLVTM
DVELADRTLSVAVTPVQAVVLLYFQDQASWTLEELSKVVKMPVALLRRRMSVWLQQGVLR
EEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLE
SLSLERIYSMLRMFVMTGPALAEIDLQELQGYLQKKVRDQQLIYSAGVYRLPKNCN
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggaggccgagggtgtggcggtatcggtggcggcggcggcggcggcgacaacgacaatt
gtcgccacggatgactgcgactctaggcctggacaggagctcgtggttgcctggaatact
gtgagcaccggtctggtgccgccggctgcgctggggctggcatcttcccggaccagcggt
gcagttccaccaaaggaggaagagcttcgtgcagcggtagaagttctgagggcccacggt
ctgcactctgtcctggaggagtggttcgtggaagtgctgcagaatgaccttcaaggcaac
attgccacggagttctggaatgccatctcccttcgcgaaaactctgtcgatgaaccccaa
tgccttgtgctgctcctggatgcgttcggtctgctggaaagccgcttggatccctatctg
catagcctagaactcctagagaaatggactcgtctgggcttgctgatgggcgctggagct
cagggtcttcgggagaaagttcacactatgttgcggggagtcctgtttttttccacccct
aggacattccaggagatggtccagcgcctctatggtcgtttcctgagagtctatatgcag
agcaagagaaaaggagaagggggcacagatccagaactagagggagagctggacagccgg
tatgcccgccgcaggtactaccgacttttgcagagccctctgtgtgcaggatgtggcagt
gacaagcagcagtgctggtgccggcaggccctggagcagttcaaccagctcagccaggtc
ctgcataggctcagtctgctggagcgggttagcgctgaggccgtgaccaccaccctgcat
caggtgacccgggaaaggatggaagaccgctgccgaggagagtatgagcgctctttcttg
cgtgagttccacaagtggatcgagagagtggttggttggcttggcaaagtgttccttcag
gacaaccccagcagaccaacttctccagaagctgggaacacactgcgtcgttggcgctgt
cacgtacagagattcttctaccgaatctatgccagcctacgtattgaggagcttttcagc
atcatccgagacttcccagactctcggccagccattgaggaccttaagtactgcttggag
aggacggatcagaggcagcagctcctcgtgtccctcaaagtggccctagagactcgactc
ctccacccaggtgtcaacacgtgtgacatcatcacactctacatttctgccatcaaggca
ttacgtgtgctagatccctctatggtcatcctggaggtggcctgtgagcccatccgtcgc
tacctgaggacacgggaggacacagtacggcagattgtggctgggctaaccggggactcg
gatgggactggggacttggctgttgagctgtctaagactgacccggcctgcctggagacc
ggccaggacagtgaggatgactctggcgagcccgaggactgggtccctgaccctgtggat
gctgatccagcaaagtcaagttccaagcgacgctcttcagacatcatcagcctgctggtc
agcatctatggcagcaaagacctgtttatcaatgagtaccgctccctcctggccgatcgc
ctcctccaccagttcagcttcagtccggagagggagattcgtaatgtggagctgttgaag
ctgcgctttggagaagcccccatgcacttctgtgaggtcatgctcaaggacatggcagat
tcccgccgcatcaatgccaatatccgtgaggaggatgagaagcggcctgtggaagaacag
ccaccatttggggtctatgccgtcatattgtccagtgaattttggcctcccttcaaagat
gagaagctggaggtccctgaggacatcagggcagccctggatgtttactgcaagaagtat
gagaaactgaaggctatgcggacactcagttggaagcataccctgggcctggtgacgatg
gacgtggagctggctgaccgcaccctgtctgttgcggtcaccccagtgcaggcagtggtt
ttgctgtatttccaggaccaagccagctggaccttggaggagctgagcaaggtggtgaag
atgcccgtggcactcctacgaagacgcatgtcagtgtggctgcagcagggtgtgctgcgg
gaggagcctcccggcactttctctgtcattgaggaagagcggcctcaggatagggacaac
atggtgctgattgacagtgatgatgaaagtgactcgggcatggcctcccaggctgaccag
aaggaagaggagctactgctcttttggacatacatccaggccatgttgaccaacctagag
agcctctctctggagcgcatctacagcatgctccgaatgtttgtaatgactggccctgca
ctggctgagattgacctgcaggaactacagggctacttgcagaagaaggtccgagaccag
cagctcatctactctgcaggtgtctaccgcctgcctaagaactgcaactga

KEGG   Rattus norvegicus (rat): 304490
Entry
304490            CDS       T01003                                 

Symbol
Anapc7
Name
(RefSeq) anaphase-promoting complex subunit 7
  KO
K03354  anaphase-promoting complex subunit 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    304490 (Anapc7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    304490 (Anapc7)
   04114 Oocyte meiosis
    304490 (Anapc7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    304490 (Anapc7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    304490 (Anapc7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    304490 (Anapc7)
   03036 Chromosome and associated proteins [BR:rno03036]
    304490 (Anapc7)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     304490 (Anapc7)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    304490 (Anapc7)
SSDB
Motif
Pfam: TPR_2 TPR_8 TPR_16 TPR_14 TPR_1 TPR_19 ANAPC3 TPR_7 TPR_11 TPR_17 TPR_12 TPR_21 TPR_10 BTAD
Other DBs
NCBI-GeneID: 304490
NCBI-ProteinID: NP_001100612
RGD: 1311927
Ensembl: ENSRNOG00000001283
UniProt: D3ZIT4
Position
12
AA seq 565 aa
MSVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPSQKYQLLVYHADSLFHDKEYR
NAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKLDKD
AIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSV
KGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAINTICSLEKKSLLRDNVDLL
GSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNI
SDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAII
HFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLED
PVTQEKAKTLLDKALAQRPDYVKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRI
LGDFLVSVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEGSPTDATQEDDVDDMEGSG
EEGDLEGSDSEAAQWADQEQWFGMQ
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgagtgtgatagatcatgtgcgggacatggcggccgctgggctgcactccaacgtgcgg
ctcctcagcagcttgctgctgaccatgagtaataacaaccctgagctgttttccccgtct
cagaagtaccagcttctggtgtatcatgcagattctctctttcacgataaggaataccgc
aatgctgtgagtaagtataccatggctttacagcagaagaaagccttaagtaaaacttca
aaggtgcgaccttcaactggaaattctgcatctactccacagagccagtgtcttccatcc
gaaattgaagtgaaatacaaaatggctgagtgctacacaatgctgaaactggacaaggac
gccattgctatactcgatgggatcccttcaagacaaagaacccccaaaataaacatgatg
ttggcaaacctgtacaagaaggctggtcaggaacgcccgtcggtcaccagctataaggag
gtcctgcggcagtgccctttggcccttgacgccattctaggtttgttatccctgtctgtg
aaaggtgcagaggtggcatcgatgacaatgaatgtgatccagactgtgcccaacctggac
tggctgtccgtgtggattaaagcatacgcttttgtgcatactggtgacaactcaagagcg
atcaacaccatctgttcgctagagaaaaaatccttactgcgagacaatgtggacctgctg
gggagcctggcagacctgtacttcagagcaggagacaacaagaactcagtcctcaagttt
gagcaggcccagatgctggacccttacctgataaaagggatggatgtttatggctacctc
ttggcacgagaagggcggctagaggatgtggagaaccttggctgccgccttttcaatatt
tctgatcagcatgccgagccttgggtggtctccggatgccacagcttctacagtaagcgc
tactcccgggccctgtacttaggcgccaaggccattcaactgaacagcaacagtgtccaa
gctttattactcaaaggagcggcgcttagaaacatgggaagagtccaggaagctataata
cattttcgggaggccataaggcttgcgccttgtcgcttagactgttacgaaggtctcata
gaatgttacttagcttctaacagcatccgagaggccatggtgatggccaacaatgtttac
aaaactctgggtgcaaacgctcagacgcttaccctgttagccaccgtgtgtctggaagat
ccagtgacacaggagaaagccaaaaccttgttagacaaagccctggcccagaggccggac
tacgtcaaggccgtggtgaagaaggcagaattgctgagcagggagcagaagtacgaagat
ggaattgctctgctgagaaatgcactggccaaccagagcgactgcgtcctgcaccgcatc
ctgggggacttcctggtgtctgtgaatgagtaccaggaagcaatggaccagtatagcata
gcactgagtttggaccccaatgaccagaagtccctggagggcatgcagaagatggagaag
gaggggagccccacagacgccactcaggaggacgacgtggacgacatggagggcagtggg
gaagaaggggacctggagggtagcgacagtgaggcagcccagtgggctgaccaggagcag
tggtttggcatgcagtga

KEGG   Rattus norvegicus (rat): 305420
Entry
305420            CDS       T01003                                 

Symbol
Anapc4
Name
(RefSeq) anaphase-promoting complex subunit 4
  KO
K03351  anaphase-promoting complex subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    305420 (Anapc4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    305420 (Anapc4)
   04114 Oocyte meiosis
    305420 (Anapc4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    305420 (Anapc4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    305420 (Anapc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    305420 (Anapc4)
   03036 Chromosome and associated proteins [BR:rno03036]
    305420 (Anapc4)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     305420 (Anapc4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    305420 (Anapc4)
SSDB
Motif
Pfam: ANAPC4 ANAPC4_WD40
Other DBs
NCBI-GeneID: 305420
NCBI-ProteinID: NP_001100690
RGD: 1306572
Ensembl: ENSRNOG00000004130
UniProt: D3ZUB7
Position
14
AA seq 807 aa
MLRFPTCFPSFRVVGEKQLPQEIIFLAWSPKRDLIALANTTGEVLLHRLASFHRVWSFPP
NESTGKEVTCLAWRPDGKLLAFALADTKKIILCDVEKPESLHSFSVEAPVSCMHWMEVTV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYNSTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIAGTCIALCLSSDLKSLSVVTEVSSGGESEVSYFQLETNL
LYSFLAEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKTTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDASSIEDAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSNHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKP
ADVIGRSMNQAICIPLYKDARSMDGARRLLKFPFLWNNKTSNLHYLLFTILEDSVYKMCI
LRRHTDSSQSVSNGLIGIKFGSFTYATTDKVRRSTYSCLDAQFYDDETVTVILKDSMGRE
GRDRILVQLPLSLVYNSEDSDEYEFTGTCSTRLDEQGSIIPTRTMHFEKHWRLLESMKAQ
YVAGNGLRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDDDEEAAGKPVKIKEEVLSESE
TEAHQDAAALDSDVVIKVEKLDPELDS
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgctgcgctttccgacctgtttcccatcctttcgggtggtgggagagaagcaactgccg
caagagattattttcttggcctggtcacccaagcgagacctcattgctttggccaacact
acaggcgaggttttactgcatcgccttgcaagttttcatcgcgtctggagttttccacca
aatgaaagtacaggaaaagaagtgacctgcttggcctggagaccagatggcaaacttttg
gcctttgctcttgcggataccaaaaaaattattttgtgtgatgtagaaaagcctgaaagc
ttacactctttctctgtggaggctccggtgtcttgtatgcattggatggaagtgacggtt
gaaagcagtgtcttaacatcattttataacgctgaggatgagtccaatcttcttttgcct
aagctgcccacattgccaaaaaattacaacagcacctcaaaaatatttagtgaagaaaat
tctgatgaaattattaagctcttgggagatgtcaggctgaacatccttgtccttggagga
agttctggatttattgagctttatgcttatgggatgttcaaaattgctcgagtaacaggg
attgccggtacttgtattgctctgtgtttatcaagtgatttgaagtcgttatcagtggtc
acagaggtctccagtggtggtgaatcagaagtttcctattttcagcttgaaaccaatctg
ctgtattccttcttagctgaagtaactcggatggccagaaagtttactcacatttcggct
ctcttacagtacataaatttgtcgctgacatgtatgtgtgaagcgtgggaagaaatcctg
atgcagatggactcccgtctcactaagtttgtacaggaaaaaactacaaccacatcggta
caggatgagttcatgcacttactgttgtgggggaaagccagtgctgaacttcagactctc
ctgatgaaccagttaacagtgaagggcttaaaaaagcttggccagtctatagagtcatca
tattccagtatacaaaaactggttataagtcacttacagagtggctcagagtctttactc
tatcacttgagtgaacttaaagggatggcctcatggaaacagaaatatgaacctctagga
ctggatgcttcaagcattgaagatgctattactgctgtgggttctttcatccttaaagca
aatgaacttctccaagttatagatagtagtatgaaaaacttcaaggcattttttcggtgg
ctatatgtagcaatgctgagaatgacagaggaccacgtgcttcctgagctgaacaagatg
actcagaaggatatcacatttgttgctgaattcctcactgaacatttcaatgaggctcca
gacctttataatcggaaaggaaaatacttcaatgttgaaagagttggtcagtatttgaaa
gatgaagatgacgaccttgtgtcaccccctaacacagaaggaaaccagtggtatgacttc
ctccagaacagcaaccacctaaaagaaagtcctttgctgtttccttactaccctcgaaaa
tcactgcattttgtgaaaaggcgaatggagaacattattgatcagtgtttgcaaaagcca
gcagatgtaattggaagatcgatgaatcaagcaatttgcattccattatataaagatgct
aggagtatggatggtgcacgtagattgttaaaattcccattcttgtggaataataaaact
tcgaatcttcattatcttctttttactattttagaagattcagtttataaaatgtgcatc
ttaaggagacatactgatagttcccaatctgtaagtaatggactaattggtatcaaattt
gggagcttcacatatgccacaactgacaaagtcagaagaagcacttacagttgtctggat
gcccagttttatgatgacgagactgtcacagtcatccttaaggactccatgggacgtgag
ggaagagacaggattttggttcagttgccactgtccttggtgtataacagtgaagactct
gacgagtatgagttcactgggacttgctccaccaggcttgatgagcagggcagcattatt
cccacacgcaccatgcactttgagaagcactggaggctgctggaaagcatgaaggcacag
tatgttgctgggaatggccttcggaaagtgtcctgtgtgttaagttcaaacctccggcac
gtgagggtgtttgaaatggacatcgatgatgaatgggagcttgacgagtcttcagatgat
gacgaggaggctgccgggaagcctgtgaagatcaaggaagaggtgttgtcagagtcggag
acagaggctcaccaagatgctgctgccctagactcagacgtagtcatcaaagtggagaaa
cttgaccctgagttggactcctga

KEGG   Rattus norvegicus (rat): 311412
Entry
311412            CDS       T01003                                 

Symbol
Anapc1
Name
(RefSeq) anaphase-promoting complex subunit 1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    311412 (Anapc1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    311412 (Anapc1)
   04114 Oocyte meiosis
    311412 (Anapc1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    311412 (Anapc1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    311412 (Anapc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    311412 (Anapc1)
   03036 Chromosome and associated proteins [BR:rno03036]
    311412 (Anapc1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     311412 (Anapc1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    311412 (Anapc1)
SSDB
Motif
Pfam: Apc1_MidN Apc1_N APC1_C ANAPC1 PC_rep
Other DBs
NCBI-GeneID: 311412
NCBI-ProteinID: NP_001101241
RGD: 1306629
Ensembl: ENSRNOG00000016965
UniProt: F1M801
Position
3
AA seq 1944 aa
MSNFSEERATMIAAGDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGVSEIGDAADYDEELYVAGNMVIWSKGSKSQALAVYKAFTVD
STVQQALWCDFIISQDKSEKIYKSHELEKCICILQSSCMNMHSIDGKDYIASLPFQVANV
WATKYGLLFERSSSSHEVPPSLPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DPAVKIVFLNIDPSIVMTYDAVQNVHSVWTLRRVKPEEETAVLKFPEQAGTLQNAATSSS
LTAHLRSLSKGESPVASPFQNYSSIHSQSRSASSPSLHSRSPSISNMAALSRAHSPALGV
HSFSGVQRFNLSSHNQSPKRHSISHSPSGSFNDSFLAPETEPIVPELCIDHLWTETLPNM
REKNSQASKVFITTDLCGQKFLCFLVEAQLQLRCVKFQESNDKTQLIFGSVTNIHAKDAA
PVEKIDTMLVLEGNGNLVLYTGVVRVGKVFIPGLPAPSLTMSNMMPRPSTPLDGVSTPKP
LSKLLGSMDEVVLLSPVPELRDSSKLNDSLYNEDCTFQQLGTYIHSVRDPVHNRVTLELS
NGSMVRITIPEVATSELVQTCLQAIKFILPKEVAVQVLVKWYNVHSAPGGPSCHSEWSLF
VICLLNMMGYNTDRLAWTRSFDFEGSLSPVIAPKKARPSDTGSDDDWEYLLNSEYHHNVE
SHLLNKSLCLNALEVTKTKDEDFPQNLSLDSSTLLFAHIPAIFFVLHLVYEELKLNTLMG
EGICSLIDLLVQLARDLKLEPYLDHYYRDYPTLVKTTGQVCTIDQGQMGFMHHPSFFTSE
PPSIYQWVSSCLKGEGTPPYPYLPGICERSRLVVLSIALYTLGDESCVSDETSQYLSKVT
LTPQKPQAEQEENRFTFRQSASVSVLAERLVVWMASVGFTLRDLETLPFGIALPIRDAIY
HCREQPDSDWSEAVCLLIGRQDLSKQACEGNLPRGKSVLSSDVASGAEAEEEDDGMNDLN
HEVMSLIWSEDLRVQDVRRLLQSAQPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMAL
PVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMASWASFHNG
VAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHVPALLPPTSTELDVPHNVQVAAVVGIGLV
YQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLN
VPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNN
RSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMNYLS
APNASVTGPYNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHM
ALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLV
PVDVDTNTPCYALIEVTYKGTQWYEQTKEELMAPTLLPELHLLKQMKVKGPRYWELLIDL
SKGEQHLRSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISS
FTSDPALLSFAEYFCKPTVSMGQKQEILDLFSSILYECVAQETPEMLPAYIAMDQALRSL
KKRDMSNTSDLWQIKLILEFFSSRSHQERQQTYPKRGLFINSEFLPVVKCTVDSTLDQWL
QAGGDVCVHAYLSGQPVEKSQLNMLACFLVYHSVPAPRHLPPLGLEGSTSFAELLFRFRH
LKMPVRALLRLAPVLLGNPQPMVM
NT seq 5835 nt   +upstreamnt  +downstreamnt
atgtcgaacttctctgaagaaagggcaacgatgattgcagccggggatctgcaggaattc
gttccttttggtcgagaccactgcaagcaccaccctaatgctctgaaccttcagcttcgt
cagctgcagccagcttctgagttatggtcttccgatggtgcagctggcttggtgggatct
cttcaggaggttacgatccatgagaaacagaaggaaagctggcagttaagaaaaggcgtg
agcgagattggagatgcagccgactatgatgaagagctctatgtggctgggaacatggtt
atctggagcaaagggagtaaaagccaggccttggcagtgtacaaagccttcacagtggac
agcactgttcagcaggcattgtggtgtgacttcattatatcacaggataagtccgaaaag
atctataagagccatgaactagagaaatgcatatgtatattacagagctcgtgtatgaac
atgcacagcatagacgggaaggattacatagcttccttaccatttcaggtggcaaacgtg
tgggccactaagtatggcttgctgtttgaacgaagcagttcttcacatgaggtgcctcca
agtctacctagagagcctttgcctaccatgttcagcatgctgcaccctctggatgagata
actccacttgtttgtaaatccggaagtctttttggctcatcgcgggtgcagtatgttgta
gatccagcagtgaaaattgtgtttctgaacattgacccctccattgtaatgacctatgat
gctgttcagaatgtgcattctgtgtggactctcaggagggtaaagccagaggaagagact
gctgttttaaagttccctgagcaggcagggaccctgcagaatgcagccactagcagctcc
ctgacagcacatctcagaagcctctccaaaggcgagtcccctgttgcttcgccgttccag
aattactcttccattcacagccagagccgctcagcctcctcacccagcctacactcccgg
tcgccttccatttccaacatggcggctctaagtcgtgctcactctcctgccttaggtgtg
cactctttctcaggggtgcaaagattcaacctttcaagccacaatcagtcaccaaagaga
cacagtatttcccactctccgagtggcagtttcaacgattcatttttggcaccagaaaca
gagccaattgttcctgagctttgcattgaccacttgtggactgagacacttccgaatatg
agagagaaaaattctcaggcctccaaggtatttataacgactgacctgtgtggacagaag
ttcctgtgctttttagtggaggcccagcttcagttacgctgtgtaaagtttcaagagagt
aatgacaagactcagcttatctttggctctgtcaccaacatacatgcaaaagacgcagcc
ccagtggagaagatagacaccatgttggtactcgaaggcaatgggaatctggtgctgtac
acaggagtggttcgggtggggaaagtgtttattcctggacttccagctccttccctgaca
atgtccaacatgatgcctcggcccagtaccccactcgatggtgttagcactccgaagcct
cttagcaaattacttggatcaatggatgaggtggttcttctgtctccagttccagaattg
agggattcttcaaaacttaacgattctctctacaatgaggattgtacattccagcagctt
ggaacttacattcattcagtgcgagaccctgttcataacagagtcactctagaactgagc
aacggctccatggttaggatcactatccctgaagtggccacctcggaattagtgcaaacg
tgtctgcaagcaattaagttcatcctgccgaaagaagtagcagttcaggtgctcgtcaag
tggtacaatgtgcacagtgctccgggaggacccagttgtcactcagagtggagtttattt
gtgatttgtctcttgaacatgatgggttataacacagaccgcttagcatggacgcgaagt
ttcgactttgaaggatcactttccccagtcattgcacccaaaaaagcgaggccctctgat
actgggtctgacgatgactgggagtacttactgaattcagagtaccatcataatgttgag
tctcatcttttgaacaaatctctatgtttgaatgctttggaagttacaaagacaaaagat
gaagattttccacaaaacctcagtctggattcttctactcttctctttgctcacattcct
gcaattttttttgttcttcacctggtttatgaagagcttaagttaaatactctaatggga
gaaggaatttgttctctaattgacctccttgttcagttggcaagggacttaaaattggag
ccttacttggaccattactacagagattacccaactcttgtcaaaactactggacaagtg
tgtaccattgaccaaggtcagatgggatttatgcatcatccctcattttttacttccgag
ccaccaagtatttatcagtgggtgagttcgtgcctgaagggcgaaggaacgccaccctat
ccctacctccctgggatctgcgagaggagcaggctggtggtcttgagtattgccctctac
acccttggtgatgagagttgtgtttctgatgaaacctcccagtatttatccaaagtaacc
ttaactccccaaaagccacaagcagaacaagaagaaaacaggtttactttccggcagtct
gcttctgtgtctgttctggctgagagactggttgtctggatggccagtgtaggattcact
ttaagagatctggagactcttccctttgggattgctcttcccatcagagatgcaatctac
cactgtcgggagcagcctgattcagattggtcagaagccgtctgtctcctgattggacgt
caggacctttccaagcaggcttgcgaaggaaatttacccagaggcaaatctgtgctctca
tcagatgtggcttcaggagctgaggctgaggaggaagacgatggcatgaatgacttgaac
catgaggttatgtcattaatatggagtgaagatttacgggtgcaggatgtgcgaaggcta
cttcaaagtgcacagcctgtccgtgtcaatgtggtacagtacccagaactcagtgaccat
gagttcattgaggaaaaagaaaacaggctgctccagttgtgtcagcgaactatggccctt
ccagtaggacgagggatgtttaccttgttctcataccatcctgttccaacagagccgttg
cccattcctaaattgaatctgacagggcgagcccctccgagaaacacaactgtagatctt
aatagtgggaacatcgatgtgcctcccaatatggcaagttgggccagctttcataatggt
gtggctgctggcctgaagatagcccctgcctcccagatagactcagcttggattgtttac
aacaagccaaagcatgctgagttagccaatgagtacgcaggctttctcatggccctaggt
ctgaatgggcaccttaccaagctggctactctcaatatccatgactacttgaccaagggc
catgaaatgacaagcattggattgctacttggtgtttctgctgcaaaacttggcaccatg
gacatgtcaattacccggcttcttagcattcacgttcctgctctcttacccccgacatcc
acagagcttgatgtgcctcacaatgtccaagtggcggctgtggttggcattggccttgtt
tatcaaggcacagctcacagacatactgcagaagtcctgttggctgaaatagggcggccc
cctggtccagaaatggaatattgcactgacagagaatcctactccttagctgctggcctg
gccctgggcatggtttgcttggggcatggcagcaatttgattggcatgtctgacctcaat
gtgcctgagcagctgtatcagtacatggtcggaggtcacaggcgttttcaaactggaatg
cacagggagaaacataagtctccaagttaccagatcaaagaaggagataccataaacgtg
gacgtgacttgtccaggcgctactctggctctggctatgatctacttgaaaaccaataac
agatctattgctgattggctgcgagctcctgataccatgtatttgctcgactttgtgaaa
ccagagttcctcttgcttaggacacttgctcggtgcctgatcctgtgggatgacatttta
ccgaattccaagtgggttgacagcaatgttcctcagattataagagaaaatagtatctct
ctgagtgagattgaattgccttgttcagaggacttgaatttggaaaccttgtcgcaagca
cacgtctacatcatcgcaggagcctgcttgtctctgggttttcgatttgctggctcagag
aacttatcagcatttaactgtctgcataaatttgcaaaagattttatgaattatttatct
gcacccaatgcttctgtaacagggccctacaacctcgaaacctgcctgagtgttgtcctg
ctgtctcttgccatggtgatggctggctctgggaacctgaaggtgttgcagctctgccgc
ttcctgcatatgaagacgggcggagagatgaactatggcttccacttggcccaccacatg
gccctgggccttctctttttgggaggaggaaggtactctttgagcacatccaactcatcc
attgctgcccttctctgtgccctttacccacatttcccagcccacagcactgacaaccgg
tatcatctccaggcccttcggcacctctacgtgctggctgcagaaccaaggctcctggtg
cctgtggatgtggatacaaacacaccctgctatgcccttatagaagttacttacaagggc
actcagtggtatgaacagaccaaagaagaactgatggctccaaccctgcttccagaactc
catcttctaaagcagatgaaggttaaagggccaagatactgggaactgctcatagattta
agcaagggagagcagcacttgaggtccattctttccaaggatggagttttatatgtaaag
ctcagggcaggccagctctcctacaaagaagacccaatggggtggcagagtctgttggca
cagactgtggctaacaggaactcagaggcccgggctttcaagccagaaacaatttcatca
ttcacttctgatccagcacttctgtcatttgctgaatatttctgcaagccgactgtgagc
atgggccaaaaacaggagattctggacctcttttcttccatactttatgagtgtgttgct
caggaaactccagagatgttgcctgcctacatagcaatggatcaggctttaagaagtctt
aaaaagagagacatgtcgaacacatctgatctttggcagataaagttgatattagagttt
ttcagttcacgaagccaccaggaaaggcagcagacctatcctaagcgagggctcttcata
aactcggagttcctacctgtggtgaagtgcactgttgattccaccctggaccagtggcta
caagctggaggcgatgtgtgtgtgcatgcctaccttagtgggcagcctgttgagaagtct
cagctaaacatgctggcctgcttcctggtctaccactctgtgccagcaccgcgacacttg
ccacccctgggactggaagggagcacaagctttgctgaactcctcttcaggttcagacac
ctaaaaatgccagtccgcgctttgctgagactggctcctgtgctgctcgggaatccacag
ccgatggttatgtga

KEGG   Rattus norvegicus (rat): 360643
Entry
360643            CDS       T01003                                 

Symbol
Cdc27
Name
(RefSeq) cell division cycle protein 27 homolog
  KO
K03350  anaphase-promoting complex subunit 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    360643 (Cdc27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    360643 (Cdc27)
   04114 Oocyte meiosis
    360643 (Cdc27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    360643 (Cdc27)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    360643 (Cdc27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    360643 (Cdc27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    360643 (Cdc27)
   03036 Chromosome and associated proteins [BR:rno03036]
    360643 (Cdc27)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     360643 (Cdc27)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     360643 (Cdc27)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    360643 (Cdc27)
SSDB
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_16 TPR_17 TPR_19 TPR_14 TPR_9 TPR_6 ChAPs PPTA TPR_MalT TPR_20 Cas_Cas02710
Other DBs
NCBI-GeneID: 360643
NCBI-ProteinID: NP_001019964
RGD: 1304921
Ensembl: ENSRNOG00000005904
UniProt: Q4V8A2
Position
10
AA seq 824 aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDLVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTALVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDNVPLGTGPSILSKQVQNKPKTGRSLLGGPTALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVPSTGAPTKKSVARMGHTGAKSVFSQSGNSREATPVLVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYSTGWVLCQIGRAYFELSEYMQAERIFSEVRRIESFRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgacggtgctgcaggaacctgtccaggctgctatatggcaagcactaaaccactatgct
taccgagacgcagttttcctcgcagaacgactatatgcagaagtacattcagaagaagcc
ttgtttctactggcgacctgttactaccgctcaggaaaggcctataaagcctatagactc
ttgaaaggacacagttgtaccaccccgcagtgtaaatacctgcttgcaaaatgttgtgtt
gacctcagcaagcttgcagaaggggaacaaatcttatctggtggagtgtttaataagcaa
aaaagccatgacgaccttgtcactgagtttggtgattcagcttgcttcactctttccttg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcgttatgtgaaataggtgag
aagccagatcctgaccaaacatttaaattaacatctctacagaattttagcagttgtctt
cccaacacgtgtacagctctagtatctaaccacagtttatctcacagacagcctgagaca
gtccttacagaaactccccaagacacgattgaattaaacagactgaacttagaatcttcc
aattcaaagtactccttgaatacagattcctccgtgtcttacattgattcagctgtaatt
tcaccagataacgtcccccttggaactggtccttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccaactgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacaccttctgtaattgacgtgccatccaccggagcacctactaaaaagtcc
gttgcaagaatgggccacactggagcgaagtctgtcttctcacagagtgggaacagtcgg
gaggccacaccggtgctcgttgcccagacacaaagctctggcccacaaacaagtacaaca
cctcaggtattgagccccactattacatctcccccaaatgcattgcctcgaagaagttcc
cgccttttcactagtgacagttctacaaccaaggagaatagcaaaaagttaaaaatgaag
tttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataact
caacccaacataaacgatagtctggaaattacaaaattggactcttctatcatttcagaa
gggaaaatatccacaatcacacctcagatccaggcatttaacctacaaaaggcagcagca
ggtttgatgagccttcttcgtgaaatgggaaaaggttatttagctttgtgttcatacaac
tgcaaagaagctataaatattctgagccacctaccttctcaccactacagtactggctgg
gtcctgtgccagattggacgggcttattttgaactttcagaatacatgcaggctgaaaga
atattctcagaagttagaaggattgagagtttcagagttgagggtatggagatctactct
acaacactctggcatcttcagaaagatgttgctctttcggttctttcaaaagatttaaca
gacatggataagaattcaccagaggcttggtgtgctgcagggaattgtttcagtctacaa
cgggagcatgatatagcaattaaattcttccaaagagctatccaggtggatccaaattat
gcttatgcctatactctattaggacatgaatttgtgttaactgaagaactagataaagca
ttagcatgttttcgaaatgctataagagtaaatcccagacattataatgcatggtatggt
ttagggatgatttattacaagcaagagaaattcagcctcgcagaaatgcatttccagaaa
gcacttgatatcaaccctcagagttcagttttactttgccacattggagtagttcagcat
gcactcaagaagtctgagaaggctttggataccctaaacaaagccattgttatagatccc
aagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatacaag
tctgctttacaagaacttgaagaactgaaacagattgtccccaaagaatccctcgtttac
ttcttaataggaaaggtttacaagaagttgggtcaaactcatctcgccttgatgaatttc
tcttgggctatggatttagatcctaaaggagccaataatcagattaaagaggcaattgac
aagcgctaccttccagatgatgaggagccgataacccaggaggagcagatcatgggaaca
gatgaatcccaggagagcagcatgacagatgcagatgacactcaacttcatgcagcggaa
agtgatgaattttaa

KEGG   Rattus norvegicus (rat): 361389
Entry
361389            CDS       T01003                                 

Symbol
Anapc10
Name
(RefSeq) anaphase-promoting complex subunit 10
  KO
K03357  anaphase-promoting complex subunit 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    361389 (Anapc10)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    361389 (Anapc10)
   04114 Oocyte meiosis
    361389 (Anapc10)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    361389 (Anapc10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    361389 (Anapc10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    361389 (Anapc10)
   03036 Chromosome and associated proteins [BR:rno03036]
    361389 (Anapc10)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     361389 (Anapc10)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    361389 (Anapc10)
SSDB
Motif
Pfam: ANAPC10 F5_F8_type_C PITH
Other DBs
NCBI-GeneID: 361389
NCBI-ProteinID: NP_001101915
RGD: 1308936
Ensembl: ENSRNOG00000018296
UniProt: B5DEP3
Position
19
AA seq 185 aa
MTTPNKTPPGADPKQLERTATVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaccacgccaaacaagacacctcctggtgctgaccctaagcagttggagaggacagca
acagtgagggaaattgggtctcaggctgtctggtcactctcttcctgcaaaccagggttt
ggagtggatcaattacgagatgacaatctagagacttactggcaatccgatggctctcag
cctcatttagtgaacatccaattcagaagaaaaacaacagtgaagacgttatgtatttat
gcagactataaatctgatgaaagctacactccaagcaaaatctcagtcagagtaggaaat
aattttcacaaccttcaagaaatccggcaactcgaattggtggagccaagtggctggatt
cacgttcctttaactgacaaccataagaagccaacgcgcacattcatgatacagattgct
gttctggccaatcaccagaacggaagggatacccacatgagacagattaaaatatacacg
ccagtggaagagagctccattgggaaattccctagatgcaccaccatcgatttcatgatg
tatcgttcaatacggtga

KEGG   Rattus norvegicus (rat): 366381
Entry
366381            CDS       T01003                                 

Symbol
Cdc26
Name
(RefSeq) anaphase-promoting complex subunit CDC26
  KO
K03359  anaphase-promoting complex subunit 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    366381 (Cdc26)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    366381 (Cdc26)
   04114 Oocyte meiosis
    366381 (Cdc26)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    366381 (Cdc26)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    366381 (Cdc26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    366381 (Cdc26)
   03036 Chromosome and associated proteins [BR:rno03036]
    366381 (Cdc26)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     366381 (Cdc26)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    366381 (Cdc26)
SSDB
Motif
Pfam: ANAPC_CDC26
Other DBs
NCBI-GeneID: 366381
NCBI-ProteinID: NP_001013258
RGD: 1311342
Ensembl: ENSRNOG00000029785
UniProt: Q6YDN7
Position
5
AA seq 85 aa
MLRRKPTRLELKLDDIEEFENIRKDLEARKKQKEDVEGVGTSDGEGAAGLSSDPKSREQM
INDRIGYKPQLKTNNRTSQFGNFEF
NT seq 258 nt   +upstreamnt  +downstreamnt
atgctgcgacgaaagccaactcgcctggagctcaagctcgatgacattgaggagttcgag
aacattcgaaaggacctggaggcccgtaagaaacagaaggaagatgtggaaggtgtagga
actagcgatggagaaggagctgctgggctcagcagtgaccccaagagccgggaacaaatg
attaatgatcgaattggttataaaccccaacttaagaccaacaaccgcacatctcagttt
ggaaattttgaattttag

KEGG   Rattus norvegicus (rat): 498030
Entry
498030            CDS       T01003                                 

Symbol
Anapc11
Name
(RefSeq) anaphase-promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    498030 (Anapc11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    498030 (Anapc11)
   04114 Oocyte meiosis
    498030 (Anapc11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    498030 (Anapc11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    498030 (Anapc11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    498030 (Anapc11)
   03036 Chromosome and associated proteins [BR:rno03036]
    498030 (Anapc11)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     498030 (Anapc11)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    498030 (Anapc11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX
Other DBs
NCBI-GeneID: 498030
NCBI-ProteinID: NP_001119554
RGD: 1561880
Ensembl: ENSRNOG00000036686
UniProt: D3ZXH8
Position
10
AA seq 84 aa
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLNAQQVQQHCPMCRQEWKFKE
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtgaaaattaagtgttggaatggtgtggccacttggctctgggtagccaatgat
gagaactgcggcatctgcaggatggcgttcaatggctgctgtccagactgtaaggtgcct
ggtgacgactgtcccctggtgtggggacagtgctctcactgcttccatatgcactgcatc
ctcaagtggctgaacgcacagcaggtgcagcagcactgccccatgtgtcgacaggagtgg
aagttcaaagagtga

KEGG   Rattus norvegicus (rat): 685029
Entry
685029            CDS       T01003                                 

Symbol
Anapc13
Name
(RefSeq) anaphase-promoting complex subunit 13
  KO
K12456  anaphase-promoting complex subunit 13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    685029 (Anapc13)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    685029 (Anapc13)
   04114 Oocyte meiosis
    685029 (Anapc13)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    685029 (Anapc13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    685029 (Anapc13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    685029 (Anapc13)
   03036 Chromosome and associated proteins [BR:rno03036]
    685029 (Anapc13)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     685029 (Anapc13)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    685029 (Anapc13)
SSDB
Motif
Pfam: Apc13p
Other DBs
NCBI-GeneID: 685029
NCBI-ProteinID: NP_001167454
RGD: 1583270
Ensembl: ENSRNOG00000008459
UniProt: D4A427
Position
8
AA seq 74 aa
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGGTTESVKEQEMKWTDL
ALQGLHENVPPTGN
NT seq 225 nt   +upstreamnt  +downstreamnt
atggacagtgaggtacagcgagatggaaggatcttggatcttattgacgacgcttggcgg
gaggacaagctgccatatgaggatgtagcgattccactgagtgagcttcctgagcctgag
caagacaacggcggcaccacagagtctgtgaaagaacaggagatgaagtggacagacctg
gccttgcagggcctccacgagaacgtcccacccactggaaactga

DBGET integrated database retrieval system