KEGG   Rattus norvegicus (rat): 100362121
Entry
100362121         CDS       T01003                                 

Gene name
Ddb2
Definition
(RefSeq) DNA damage-binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03420  Nucleotide excision repair
rno04115  p53 signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno05161  Hepatitis B
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100362121 (Ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100362121 (Ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100362121 (Ddb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100362121 (Ddb2)
   05202 Transcriptional misregulation in cancer
    100362121 (Ddb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100362121 (Ddb2)
   05212 Pancreatic cancer
    100362121 (Ddb2)
   05225 Hepatocellular carcinoma
    100362121 (Ddb2)
   05226 Gastric cancer
    100362121 (Ddb2)
   05214 Glioma
    100362121 (Ddb2)
   05216 Thyroid cancer
    100362121 (Ddb2)
   05220 Chronic myeloid leukemia
    100362121 (Ddb2)
   05217 Basal cell carcinoma
    100362121 (Ddb2)
   05218 Melanoma
    100362121 (Ddb2)
   05213 Endometrial cancer
    100362121 (Ddb2)
   05224 Breast cancer
    100362121 (Ddb2)
   05222 Small cell lung cancer
    100362121 (Ddb2)
   05223 Non-small cell lung cancer
    100362121 (Ddb2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100362121 (Ddb2)
   05169 Epstein-Barr virus infection
    100362121 (Ddb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    100362121 (Ddb2)
   03400 DNA repair and recombination proteins [BR:rno03400]
    100362121 (Ddb2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100362121 (Ddb2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100362121 (Ddb2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 100362121
NCBI-ProteinID: NP_001258275
RGD: 1310164
Ensembl: ENSRNOG00000014071
UniProt: D3ZR08
Position
3
AA seq 432 aa
MAPKKCPETQKSPDVAVLLKSKSRRSPQELEPEAKKLFVQGPVSSRKCESCCLLAELSSL
QIPPRSSSIVRDLYQQKLGKATWPSLQQGLQKSFLHSLASYRVFQKAAPFDRRTTSLAWH
PTHPSTLAVGSKGGDIMIWNFGIKDKPIFLKGIGAGGSITGLKFNHLNTNQFFASSMEGT
TRLQDFKGNILRIYTSSNSCKVWFCSLDVSAKSRVVVTGDNMGHVILTNTDGKELWNLRM
HKKKVAHVALNPCCDWLLATASIDQTVKIWDLRQIKGKDSFLFSLPHRHPVNSACFSPDG
ARLLTTDQNNEIRVYSASQWDSPLSLISHPHRHFQHLTPIKATWHSRHNLIVVGRYPDPN
LKSCVPYELRTIDVFDGSSGKMMCQLYDPGYSGITSLNEFNPMGDTLASTMGYHILIWSP
EEDGSLKDHERL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggctcccaagaaatgcccagaaacccagaagtcccccgacgttgcggtgctcctcaag
agcaaaagccgcagaagtcctcaggagctggagcccgaagccaagaagctgtttgtgcag
ggtcccgtttctagtaggaaatgtgagtcgtgctgccttctggcagagttgtccagcttg
cagatccctccgaggagcagcagcattgtccgggatctttaccagcagaagttgggcaaa
gccacctggccgtcactacagcagggtctccagaagtcctttttgcactctctagcttct
taccgggtattccaaaaagctgccccctttgacaggaggacaacgtccttggcatggcac
ccgactcatcccagtactttggctgtgggctccaaagggggagatattatgatctggaac
tttggcataaaggacaaacccatcttccttaaagggattggagctggaggaagcatcact
gggctgaagtttaatcatctcaataccaaccagttttttgcctcctcaatggagggaaca
accaggctgcaggattttaaaggcaacattctcagaatttataccagctcaaactcttgc
aaggtctggttttgcagccttgatgtttctgccaagagccgagtggtggttacaggagac
aatatgggacacgtgatcctgacgaacacagatggcaaggagctttggaacctcagaatg
cacaaaaagaaagtagcccatgtggccctgaacccctgctgtgattggcttctggccaca
gcctccatagatcaaacagtgaaaatttgggacctgcgccaaattaaagggaaagacagc
ttcctcttctcactgcctcacaggcatcctgtcaattcagcttgttttagccccgatgga
gctcggctcctgactactgaccagaacaatgagattcgggtttactctgcctcccagtgg
gatagccccctgagtctgatctcccaccctcaccgccattttcagcacctcacacccatc
aaggcgacctggcattcacggcacaacctcattgttgtgggccgatacccagatcctaat
cttaaaagttgtgttccctatgaactaaggacaatagatgtgtttgatggaagctcgggg
aagatgatgtgtcagctctatgatccaggatattccggtattacttcgctcaatgagttc
aatcctatgggagacacactggcttctactatgggttatcatattctcatttggagccca
gaggaagatgggtcattgaaagaccatgaaagactatga

DBGET integrated database retrieval system