KEGG   Rattus norvegicus (rat): 100911464
Entry
100911464         CDS       T01003                                 

Definition
(RefSeq) glutathione S-transferase P-like
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05215  Prostate cancer
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100911464
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100911464
   00982 Drug metabolism - cytochrome P450
    100911464
   00983 Drug metabolism - other enzymes
    100911464
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100911464
   05204 Chemical carcinogenesis - DNA adducts
    100911464
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100911464
   05215 Prostate cancer
    100911464
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100911464
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100911464
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    100911464
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100911464
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   100911464
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N
Other DBs
NCBI-GeneID: 100911464
NCBI-ProteinID: XP_038967329
RGD: 6492721
Position
5
AA seq 249 aa
MGHDGQPPDCPQGMKAITKPHPLQGGKDNGARTACSTAGGDPMPETARMEFSLKHALWKL
LETAGIISQDVETTVALFKGLFRFEVVQGWSGKLHTCLYGQLPKFEDGDLTLYQSSAILR
HVGHSFGLYGKGQREAALVDMVNDGVEDLHYRYVTLIYTIYENGKDDYMKALPGHLKPFE
TLLSQNQEGKAFIVGDQISFANYNLLDLLLVHFPLLAAYVVHLSAQPKIKAFLSSSNDVN
RPINDKGKQ
NT seq 750 nt   +upstreamnt  +downstreamnt
atgggtcatgacggtcagcccccggactgtcctcagggcatgaaagctataaccaagcca
caccctcttcaaggagggaaggataatggagcaagaactgcatgcagcactgcaggagga
gacccgatgccagaaactgctcgaatggaattttcactaaagcatgccctttggaaactt
ctagaaacagctgggattatttcccaagatgtagaaacaacagtggctttgtttaaaggt
ttgttcaggtttgaagtggttcagggatggtcgggaaaattgcacacttgtctgtatggg
cagcttcccaagtttgaggatggagacctcaccctttaccaatctagtgccatcctgagg
cacgtgggccactcttttggactttatgggaaaggccagagggaagccgccctggtggat
atggtgaatgatggggtggaggaccttcactacagatatgtcaccctcatctacaccatc
tatgagaatggtaaggacgactatatgaaggccctgcctgggcatctgaagccttttgag
accctgttgtcccagaaccaggaaggtaaagctttcatcgtgggtgatcagatttccttt
gccaattacaacttgctggacctgctgctggtccacttccccctgctcgctgcctatgtg
gttcacctcagtgcccagcccaagatcaaagcctttctgtcctcctctaacgatgtgaac
cgtcccatcaatgacaagggcaaacagtag

KEGG   Rattus norvegicus (rat): 114846
Entry
114846            CDS       T01003                                 

Gene name
Gsto1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114846 (Gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    114846 (Gsto1)
   00982 Drug metabolism - cytochrome P450
    114846 (Gsto1)
   00983 Drug metabolism - other enzymes
    114846 (Gsto1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114846 (Gsto1)
   05204 Chemical carcinogenesis - DNA adducts
    114846 (Gsto1)
   05207 Chemical carcinogenesis - receptor activation
    114846 (Gsto1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    114846 (Gsto1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    114846 (Gsto1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    114846 (Gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    114846 (Gsto1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     114846 (Gsto1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   114846 (Gsto1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 Glutaredoxin GST_C_5
Other DBs
NCBI-GeneID: 114846
NCBI-ProteinID: NP_001007603
RGD: 70952
Ensembl: ENSRNOG00000028746
Vega: OTTRNOG00000000845
UniProt: Q6AXR6
Position
1
AA seq 241 aa
MSGASARSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEIININLKNKP
EWFFEKNPFGLVPVLENTQGHLITESVITCEYLDEAYPEKKLFPDDPYEKACQKMTFELF
SKVPSLVTSFIRAKRKEDHPGIKEELKKEFSKLEEAMAKKRTAFFGGNSLSMIDYLIWPW
FQRLEALELNECIDHTPKLKLWMATMQEDPVASSHFIDAKTYRDYLSLYLQDSPEACDYG
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccggggcgtccgccaggagcctggggaagggaagcgcgccccctggcccggtcccg
gagggccagatccgagtctacagcatgaggttctgtccctttgctcagaggacgctgatg
gtcctgaaggccaagggaatccggcatgaaatcatcaacatcaacctgaagaataagccc
gagtggttctttgagaagaatccctttgggctggtgccggttctggagaacactcagggt
cacttgatcactgaatctgtcatcacttgcgagtacctggatgaagcatacccggagaag
aagttattcccagatgacccgtacgagaaagcttgccagaagatgacctttgagttattc
tcaaaggtgccgtctctggttacgagttttattagggcgaagagaaaggaagaccatccg
ggcataaaggaagaactgaagaaagagttcagcaagctagaagaggctatggctaaaaag
aggacagccttcttcggtgggaattcgctctcaatgatcgattatcttatttggccgtgg
tttcagcgactggaagcactggagctcaatgagtgtatagaccacaccccaaaactcaag
ctctggatggcaaccatgcaggaagaccccgtggcatcatcccacttcattgatgccaag
acctaccgtgattacttaagtctctacctacaggacagccccgaggcctgtgattatggg
ctctga

KEGG   Rattus norvegicus (rat): 171341
Entry
171341            CDS       T01003                                 

Gene name
Mgst1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    171341 (Mgst1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    171341 (Mgst1)
   00982 Drug metabolism - cytochrome P450
    171341 (Mgst1)
   00983 Drug metabolism - other enzymes
    171341 (Mgst1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    171341 (Mgst1)
   05204 Chemical carcinogenesis - DNA adducts
    171341 (Mgst1)
   05207 Chemical carcinogenesis - receptor activation
    171341 (Mgst1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    171341 (Mgst1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    171341 (Mgst1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    171341 (Mgst1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    171341 (Mgst1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     171341 (Mgst1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   171341 (Mgst1)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 171341
NCBI-ProteinID: NP_599176
RGD: 70927
Ensembl: ENSRNOG00000007743
UniProt: P08011 B6DYQ4
Structure
PDB: 
2H8A 5IA9 5I9K

Position
4
AA seq 155 aa
MADLKQLMDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDCAGFGKGENAK
KFLRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIA
YLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgacctcaagcagctcatggacaacgaggtgttgatggcctttacctcctatgca
acgatcattcttgccaagatgatgttcctgagctccgcgactgcattccagaggctaacc
aacaaggtttttgccaacccggaagactgtgctggcttcggcaagggggagaatgccaag
aagttccttcggactgacgagaaggtggaacgcgtgcgaagagcccacctgaacgacctt
gaaaacatcgttccctttctcggtatcggcctcctgtactccctgagcggaccggatctc
tctacagccctcattcacttcagaatctttgtgggcgctcggatctaccacaccattgct
tacttgactccccttcctcagccaaacaggggcttggcattttttgttggctacggagtt
actttgtcaatggcttacaggctgctcaggagcagactgtacttgtaa

KEGG   Rattus norvegicus (rat): 24421
Entry
24421             CDS       T01003                                 

Gene name
Gsta1
Definition
(RefSeq) glutathione S-transferase alpha-3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24421 (Gsta1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24421 (Gsta1)
   00982 Drug metabolism - cytochrome P450
    24421 (Gsta1)
   00983 Drug metabolism - other enzymes
    24421 (Gsta1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24421 (Gsta1)
   05204 Chemical carcinogenesis - DNA adducts
    24421 (Gsta1)
   05207 Chemical carcinogenesis - receptor activation
    24421 (Gsta1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24421 (Gsta1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24421 (Gsta1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24421 (Gsta1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24421 (Gsta1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24421 (Gsta1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24421 (Gsta1)
SSDB
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3
Other DBs
NCBI-GeneID: 24421
NCBI-ProteinID: NP_113697
RGD: 2753
UniProt: P04904 B6DYP8
Position
9
AA seq 221 aa
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEQFLKTRDDLARLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYAEGVADLDEIVLHYPYIPPGEKEAS
LAKIKDKARNRYFPAFEKVLKSHGQDYLVGNRLSRADVYLVQVLYHVEELDPSALANFPL
LKALRTRVSNLPTVKKFLQPGSQRKPLEDEKCVESAVKIFS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgccggggaagccagtccttcactacttcgatggcagggggagaatggagcccatccgg
tggctcctggctgcagctggagtagagtttgaagaacaatttctgaaaactcgggatgac
ctggccaggctaaggaatgatgggagtttgatgttccagcaagtgcccatggtggagatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccaccaaatacaac
ctctatgggaaggacatgaaggagagagccctcatcgacatgtatgcagaaggagtggcg
gatctggatgaaatagttctccattacccttacattccccctggggagaaagaggcaagt
cttgccaaaatcaaggacaaagcaaggaaccgttactttcctgcctttgaaaaggtgttg
aagagccatggacaagattatctcgttggcaataggctgagcagggctgatgtttaccta
gttcaagttctctaccatgtggaagagctggaccccagcgctttggccaacttccctctg
ctgaaggccctgagaaccagagtcagcaacctccccacagtgaagaagtttcttcagcct
ggcagccagaggaagccattagaggatgagaaatgtgtagaatctgcagttaagatcttc
agttaa

KEGG   Rattus norvegicus (rat): 24422
Entry
24422             CDS       T01003                                 

Gene name
Gsta2
Definition
(RefSeq) glutathione S-transferase alpha-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24422 (Gsta2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24422 (Gsta2)
   00982 Drug metabolism - cytochrome P450
    24422 (Gsta2)
   00983 Drug metabolism - other enzymes
    24422 (Gsta2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24422 (Gsta2)
   05204 Chemical carcinogenesis - DNA adducts
    24422 (Gsta2)
   05207 Chemical carcinogenesis - receptor activation
    24422 (Gsta2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24422 (Gsta2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24422 (Gsta2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24422 (Gsta2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24422 (Gsta2)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24422 (Gsta2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24422 (Gsta2)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_N_3 Ank_4
Other DBs
NCBI-GeneID: 24422
NCBI-ProteinID: NP_058709
RGD: 2754
Ensembl: ENSRNOG00000029861
UniProt: P00502 B6DYP7
Structure
PDB: 
1EV4 1EV9

Position
8
AA seq 222 aa
MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK
TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL
LKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtctgggaagccagtgcttcactacttcaatgcccggggcagaatggagtgcatccgg
tggctcctggctgcagcaggagtggagtttgatgagaagtttatacagagtccagaagac
ttggaaaagctaaagaaagacgggaatttgatgtttgaccaagtgcccatggtggagatt
gacgggatgaagctggcacagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtacaccgaaggcatttta
gatctgactgaaatgattatgcaattggtaatatgtcccccagaccaaaaagaagccaag
accgccttggcaaaagacaggaccaaaaaccggtacttgcctgcctttgaaaaggtgttg
aagagccatggccaagactaccttgtaggtaacaggctgacccgggtagacatccacctg
ctggaacttctcctctatgttgaagagtttgatgccagccttctgacctctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctgcagcct
ggcagtcagagaaagcttcccgtggatgcaaaacaaatcgaagaagcaaggaagattttc
aagttttag

KEGG   Rattus norvegicus (rat): 24423
Entry
24423             CDS       T01003                                 

Gene name
Gstm1
Definition
(RefSeq) glutathione S-transferase Mu 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24423 (Gstm1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24423 (Gstm1)
   00982 Drug metabolism - cytochrome P450
    24423 (Gstm1)
   00983 Drug metabolism - other enzymes
    24423 (Gstm1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24423 (Gstm1)
   05204 Chemical carcinogenesis - DNA adducts
    24423 (Gstm1)
   05207 Chemical carcinogenesis - receptor activation
    24423 (Gstm1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24423 (Gstm1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24423 (Gstm1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24423 (Gstm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24423 (Gstm1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24423 (Gstm1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24423 (Gstm1)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3 GST_N_4
Other DBs
NCBI-GeneID: 24423
NCBI-ProteinID: NP_058710
RGD: 2755
Ensembl: ENSRNOG00000029726
UniProt: P04905
Structure
PDB: 
5FWG 1MTC 3FYG 1GSB 1GSC

Position
2
AA seq 218 aa
MPMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDF
EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPN
LKDFLARFEGLKKISAYMKSSHYLSTPIFSKLAQWSNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcctatgatactgggatactggaacgtccgcgggctgacacacccgatccgcctgctc
ctggaatacacagactcaagctatgaggagaagagatacgccatgggcgacgctcccgac
tatgacagaagccagtggctgaatgagaagttcaaactgggcctggacttccccaatctg
ccctacttaattgatggatcgcgcaagattacccagagcaatgccataatgcgctacctt
gcccgcaagcaccacctgtgtggagagacagaggaggagcggattcgtgcagacattgtg
gagaaccaggtcatggacaaccgcatgcagctcatcatgctttgttacaaccccgacttt
gagaagcagaagccagagttcttgaagaccatccctgagaagatgaagctctactctgag
ttcctgggcaagcgaccatggtttgcaggggacaaggtcacctatgtggatttccttgct
tatgacattcttgaccagtaccacatttttgagcccaagtgcctggacgccttcccaaac
ctgaaggacttcctggcccgcttcgagggcctgaagaagatctctgcctacatgaagagc
agccactacctctcaacacctatattttcgaagttggcccaatggagtaacaagtag

KEGG   Rattus norvegicus (rat): 24424
Entry
24424             CDS       T01003                                 

Gene name
Gstm2
Definition
(RefSeq) glutathione S-transferase Mu 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24424 (Gstm2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24424 (Gstm2)
   00982 Drug metabolism - cytochrome P450
    24424 (Gstm2)
   00983 Drug metabolism - other enzymes
    24424 (Gstm2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24424 (Gstm2)
   05204 Chemical carcinogenesis - DNA adducts
    24424 (Gstm2)
   05207 Chemical carcinogenesis - receptor activation
    24424 (Gstm2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24424 (Gstm2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24424 (Gstm2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24424 (Gstm2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24424 (Gstm2)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24424 (Gstm2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24424 (Gstm2)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_N_3 GST_C_2 GST_N_2
Other DBs
NCBI-GeneID: 24424
NCBI-ProteinID: NP_803175
RGD: 2756
Ensembl: ENSRNOG00000018937
UniProt: P08010 B6DYQ2
Position
2
AA seq 218 aa
MPMTLGYWDIRGLAHAIRLFLEYTDTSYEDKKYSMGDAPDYDRSQWLSEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDVLENQAMDTRLQLAMVCYSPDF
ERKKPEYLEGLPEKMKLYSEFLGKQPWFAGNKITYVDFLVYDVLDQHRIFEPKCLDAFPN
LKDFVARFEGLKKISDYMKSGRFLSKPIFAKMAFWNPK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcctatgacactgggttactgggacatccgtgggctggctcacgccattcgcctgttc
ctggagtatacagacacaagctatgaggacaagaagtacagcatgggggatgctcccgac
tatgacagaagccagtggctgagtgagaagttcaaactgggcctggacttccccaatctg
ccctacttaattgatgggtcacacaagatcacccagagcaatgccatcctgcgctacctt
ggccggaagcacaacctttgtggggagacagaggaggagaggattcgtgtggacgttttg
gagaaccaggctatggacacccgcctacagttggccatggtctgctacagccctgacttt
gagagaaagaagccagagtacttagagggtctccctgagaagatgaagctttactccgaa
ttcctgggcaagcagccatggtttgcagggaacaagattacgtatgtggattttcttgtt
tacgatgtccttgatcaacaccgtatatttgaacccaagtgcctggacgccttcccaaac
ctgaaggacttcgtggctcggtttgagggcctgaagaagatatctgactacatgaagagc
ggccgcttcctctccaagccaatctttgcaaagatggccttttggaacccaaagtag

KEGG   Rattus norvegicus (rat): 24426
Entry
24426             CDS       T01003                                 

Gene name
Gstp1
Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05215  Prostate cancer
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24426 (Gstp1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24426 (Gstp1)
   00982 Drug metabolism - cytochrome P450
    24426 (Gstp1)
   00983 Drug metabolism - other enzymes
    24426 (Gstp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24426 (Gstp1)
   05204 Chemical carcinogenesis - DNA adducts
    24426 (Gstp1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24426 (Gstp1)
   05215 Prostate cancer
    24426 (Gstp1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24426 (Gstp1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24426 (Gstp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24426 (Gstp1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24426 (Gstp1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24426 (Gstp1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N
Other DBs
NCBI-GeneID: 24426
NCBI-ProteinID: NP_036709
RGD: 2758
Ensembl: ENSRNOG00000018237
UniProt: P04906 B6DYQ7
Position
1
AA seq 210 aa
MPPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYV
KALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAY
VARLSARPKIKAFLSSPDHLNRPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccaccgtacaccattgtgtacttcccagttcgagggcgctgtgaggccacgcgcatg
ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatgtctggctt
caaggctcgctcaagtccacttgtctgtatgggcagctccccaagtttgaagatggagac
ctcaccctttaccaatctaatgccatcttgaggcacctgggtcgctctttagggctttat
gggaaagaccagaaggaggctgccttggtggatatggtgaatgatggggtggaggacctt
cgatgcaaatatggtaccctcatctacactaactatgagaatggtaaggatgactatgtg
aaggccctgcctgggcatctgaaaccttttgagaccctgctgtcccagaaccagggaggc
aaagctttcattgtgggtaaccagatttcctttgcagattacaacttgctggacctgctg
ctggtccaccaagtcctggcccctggctgcctggacaacttccccctgctctctgcctat
gtggctcgcctcagtgcccgccccaagatcaaggcctttctgtcctcccctgaccatttg
aaccgtcccatcaacggcaatggtaaacagtag

KEGG   Rattus norvegicus (rat): 25260
Entry
25260             CDS       T01003                                 

Gene name
Gstt1
Definition
(RefSeq) glutathione S-transferase theta-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    25260 (Gstt1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    25260 (Gstt1)
   00982 Drug metabolism - cytochrome P450
    25260 (Gstt1)
   00983 Drug metabolism - other enzymes
    25260 (Gstt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25260 (Gstt1)
   05204 Chemical carcinogenesis - DNA adducts
    25260 (Gstt1)
   05207 Chemical carcinogenesis - receptor activation
    25260 (Gstt1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    25260 (Gstt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25260 (Gstt1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    25260 (Gstt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25260 (Gstt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     25260 (Gstt1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   25260 (Gstt1)
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_N_4 GST_C_3
Other DBs
NCBI-GeneID: 25260
NCBI-ProteinID: NP_445745
RGD: 2765
Ensembl: ENSRNOG00000049771
UniProt: Q01579 B6DYQ8
Position
20
AA seq 240 aa
MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDG
GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMF
PVFLGEQIRPEMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGG
GCPVFEGRPRLAAWYRRVEAAVGKDLFLEAHEVILKVRDCPPADPVIKQKLMPRVLTMIQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atggtcctggaactgtacctggatctgctgtcgcagccctgtcgcgctatttatatcttc
gccaagaagaacaatatcccgttccagatgcatactgtggagctgcgcaagggtgagcac
ctcagcgatgcctttgcccaggtgaaccccatgaagaaggtaccagccatgaaggatggt
ggcttcaccttgtgtgagagtgtggccatcctgctctacctggcgcacaagtataaggtt
cctgaccactggtacccccaagacctgcaggcccgtgctcgtgtggatgagtacctggca
tggcagcatacgacccttcggagaagctgtctccggaccctgtggcataaggtgatgttc
cccgttttcctgggtgagcagatacgcccggagatgctggcagccacattggcagatctg
gatgttaacgtacaggtgctggaagaccagttcctccaggacaaagacttccttgtcgga
ccgcacatctccctggctgacgtggtagctatcacagagctgatgcatcctgtaggtggt
ggctgcccagtctttgaagggcgtcccaggctggctgcatggtacaggagagtggaggca
gctgtggggaaggacctcttcctggaggcccatgaggtcatcctgaaggtgagagactgt
ccacctgctgaccccgtcataaagcaaaagctgatgcccagagtgctgaccatgatccag
tga

KEGG   Rattus norvegicus (rat): 289197
Entry
289197            CDS       T01003                                 

Gene name
Mgst3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    289197 (Mgst3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    289197 (Mgst3)
   00982 Drug metabolism - cytochrome P450
    289197 (Mgst3)
   00983 Drug metabolism - other enzymes
    289197 (Mgst3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    289197 (Mgst3)
   05204 Chemical carcinogenesis - DNA adducts
    289197 (Mgst3)
   05207 Chemical carcinogenesis - receptor activation
    289197 (Mgst3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    289197 (Mgst3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    289197 (Mgst3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    289197 (Mgst3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    289197 (Mgst3)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     289197 (Mgst3)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   289197 (Mgst3)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 289197
NCBI-ProteinID: NP_001178523
RGD: 1306373
Ensembl: ENSRNOG00000004245
UniProt: D4ADS4
Position
13
AA seq 152 aa
MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRA
HQNTLEVYPPFLFFLTVGGVYHPRIASGLGVAWIIGRVLYAYGYYTGDPSKRYRGAVSSL
ALFALMGTTVCSAFQHLGWIKPGLGSGSRSCH
NT seq 459 nt   +upstreamnt  +downstreamnt
atggctgtcctctctaaggaatatggattcgtgcttctcactggtgccgccagctttgtg
atggtgctccacctagccatcaacgtgggcaaagcccgcaagaagtacaaggtagagtac
cctgtcatgtacagcacagatcctgagaatgggcatatgttcaactgcattcagcgcgcc
caccagaacacattggaggtgtaccctcccttcctattcttcctaaccgtgggaggtgtt
taccacccgcgcatagcttctggcctgggcgtggcgtggattattgggcgagttctttac
gcatatggctactacacgggagaccctagcaagcggtatcgaggagctgtgagctctctt
gccctctttgccctgatgggcacaactgtgtgctctgctttccagcatctcggctggatt
aaacccggcctaggcagtgggtccagatcctgccactga

KEGG   Rattus norvegicus (rat): 293656
Entry
293656            CDS       T01003                                 

Gene name
RGD1307603
Definition
(RefSeq) uncharacterized protein LOC293656
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05215  Prostate cancer
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    293656 (RGD1307603)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    293656 (RGD1307603)
   00982 Drug metabolism - cytochrome P450
    293656 (RGD1307603)
   00983 Drug metabolism - other enzymes
    293656 (RGD1307603)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    293656 (RGD1307603)
   05204 Chemical carcinogenesis - DNA adducts
    293656 (RGD1307603)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    293656 (RGD1307603)
   05215 Prostate cancer
    293656 (RGD1307603)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    293656 (RGD1307603)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    293656 (RGD1307603)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    293656 (RGD1307603)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     293656 (RGD1307603)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   293656 (RGD1307603)
SSDB
Motif
Pfam: GST_C_3 GST_N GST_N_3 GST_C
Other DBs
NCBI-GeneID: 293656
NCBI-ProteinID: NP_001127980
RGD: 1307603
Ensembl: ENSRNOG00000018287
UniProt: D4A8S2
Position
1
AA seq 174 aa
MPPYTIIYFPSRGHCEVMRMLLADQGQSWKEEVVTLDVWEQGTFKASCLFGQIPKFQDGK
LTLYQSNAILRHLGHSFGLYGKDQQEAALVDMVNDGLEDVFRRIAWHYLHICISFADYRL
LDLLLNLELLFPGYLKDFPLLSAYVARLKARPKLKAFLESPEHVNRLLAACIKM
NT seq 525 nt   +upstreamnt  +downstreamnt
atgccaccttacaccatcatctatttcccctcccgagggcactgtgaggttatgcgcatg
ctgctagccgaccagggccagagttggaaggaggaggtggtgaccttggatgtttgggag
caaggcacattcaaggcttcctgtctgtttgggcagatccccaagttccaggatggaaag
ctcactctgtaccaatcgaatgccatcctacggcacctgggccactccttcgggctctac
ggcaaagaccagcaagaggcagcactggtggacatggtgaacgacggactggaagacgtg
ttcaggcgcattgcatggcactatctccatatctgtatctccttcgccgactaccgccta
ctggatttacttctgaacctagagctcctgttccctggttacttgaaagacttccccctg
ctctccgcctatgtagcgcgtctcaaagcccgacccaagctcaaggccttcctggagtct
cctgagcatgtgaaccgtctccttgctgcttgcataaagatgtga

KEGG   Rattus norvegicus (rat): 29487
Entry
29487             CDS       T01003                                 

Gene name
Gstt2
Definition
(RefSeq) glutathione S-transferase theta-2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    29487 (Gstt2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    29487 (Gstt2)
   00982 Drug metabolism - cytochrome P450
    29487 (Gstt2)
   00983 Drug metabolism - other enzymes
    29487 (Gstt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29487 (Gstt2)
   05204 Chemical carcinogenesis - DNA adducts
    29487 (Gstt2)
   05207 Chemical carcinogenesis - receptor activation
    29487 (Gstt2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    29487 (Gstt2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    29487 (Gstt2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    29487 (Gstt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29487 (Gstt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     29487 (Gstt2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   29487 (Gstt2)
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Oxidored_nitro
Other DBs
NCBI-GeneID: 29487
NCBI-ProteinID: NP_036928
RGD: 69362
Ensembl: ENSRNOG00000052415
UniProt: P30713 B6DYQ9
Position
20
AA seq 244 aa
MGLELYLDLLSQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDG
SFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLG
PLIGVQVPEEKVERNRNSMVLALQRLEDKFLRDRAFIAGQQVTLADLMSLEELIQPVALG
CNLFEGRPQLTAWRERVEAFLGAELCQEAHNPIMSVLGQAAKKTLPVPPPEAHASMMLRI
ARIP
NT seq 735 nt   +upstreamnt  +downstreamnt
atgggtttggagctctacctggacctgctgtcgcagcccagccgcgcggtctacatcttc
gccaagaagaatggcatcccctttcagttgcgtaccgtggatttactcaaagggcagcac
ttgagcgagcaattctcccaggtgaactgcttaaagaaagtgcctgtcctcaaagacgga
agcttcgtgttgaccgaaagcactgccatcttgatttacctgagttccaagtaccaggtg
gcagaccactggtacccggccgacctacaggcccgtgcccaagtccacgaatacctgggt
tggcatgccgacaacatccgtggcacctttggagtactcctgtggaccaaggtgttgggg
ccactcattggggtccaggttcccgaggaaaaggtggaacggaacagaaatagtatggtc
ttggctctgcaacgtctggaggacaagttcctcagggacagggccttcattgctggccag
caggtgacgctagcggatctcatgtctctagaggagttgatacagccggtggctcttggc
tgtaatctgtttgaggggcggcctcaactgacagcgtggcgagagagggtggaggcgttc
ttgggtgctgagctatgtcaggaggcgcacaaccccatcatgagcgtcctgggacaggca
gccaagaaaacattaccagtaccccctccggaggcccatgccagcatgatgcttcgaatt
gccaggattccctga

KEGG   Rattus norvegicus (rat): 295037
Entry
295037            CDS       T01003                                 

Gene name
Mgst2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    295037 (Mgst2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    295037 (Mgst2)
   00982 Drug metabolism - cytochrome P450
    295037 (Mgst2)
   00983 Drug metabolism - other enzymes
    295037 (Mgst2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    295037 (Mgst2)
   05204 Chemical carcinogenesis - DNA adducts
    295037 (Mgst2)
   05207 Chemical carcinogenesis - receptor activation
    295037 (Mgst2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    295037 (Mgst2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    295037 (Mgst2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    295037 (Mgst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    295037 (Mgst2)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     295037 (Mgst2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   295037 (Mgst2)
SSDB
Motif
Pfam: MAPEG zf_UBZ DUF6442
Other DBs
NCBI-GeneID: 295037
NCBI-ProteinID: NP_001099900
RGD: 1311218
Ensembl: ENSRNOG00000061857
Position
2
AA seq 147 aa
MAGDSSLLAAVSLLSACQQSYFALQVGRVRLKYKIAPPAVTGSLEFERIFRAQQNSLEFY
SVFIISLWMAGWYFNQVFATCLGLLYIYARHKYFWGYAEAAEKRIIGFRLSLGILALLTV
LAVLGVASRFLDEYLDFHVAKKLKRPF
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgggggattcaagcctgctggctgcagtctcccttctctctgcctgtcagcaaagt
tattttgctttgcaagtcggacgagtaagattaaaatacaagatcgcacctccagcagtc
acgggctctctggagtttgagagaatatttcgcgcacagcaaaactctttggagttttat
tccgtattcatcatatcgctgtggatggctggatggtatttcaatcaagtttttgcaacc
tgtctgggtctcctgtacatatacgcccgtcacaagtatttctggggctatgcagaagcc
gctgaaaaaaggatcattggtttccggctgagcctgggcattttggccttgctgactgtc
ctcgctgtcctgggggtagcaagcagattcctggacgaatacctggactttcatgttgcc
aagaaactgaagcggcccttctaa

KEGG   Rattus norvegicus (rat): 295362
Entry
295362            CDS       T01003                                 

Gene name
Gstm6l
Definition
(RefSeq) glutathione S-transferase, mu 6-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    295362 (Gstm6l)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    295362 (Gstm6l)
   00982 Drug metabolism - cytochrome P450
    295362 (Gstm6l)
   00983 Drug metabolism - other enzymes
    295362 (Gstm6l)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    295362 (Gstm6l)
   05204 Chemical carcinogenesis - DNA adducts
    295362 (Gstm6l)
   05207 Chemical carcinogenesis - receptor activation
    295362 (Gstm6l)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    295362 (Gstm6l)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    295362 (Gstm6l)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    295362 (Gstm6l)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    295362 (Gstm6l)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     295362 (Gstm6l)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   295362 (Gstm6l)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_6 GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 295362
NCBI-ProteinID: NP_001099934
RGD: 1311731
Ensembl: ENSRNOG00000060939
UniProt: A0A0G2K6L4
Position
2
AA seq 184 aa
MGDAPDYDRSQWLSEKFKLGLDIPNLPYLIDGSHKITQSNAILRYLGRKHNLCGETEEER
LRVDILENQAVDTRRQLSMVCYSPEFEKRKPEYLEGLPDKMKLYSEFLGKQLWFAGNKIT
YVDFLVYDVLDKHRMFELKCLDAFPNLKDFMARFETLEKISAYMKSSRFLSGPVYLKTAL
WGNK
NT seq 555 nt   +upstreamnt  +downstreamnt
atgggggacgctcccgactatgacagaagccagtggctgagtgagaagttcaaactgggc
ctggacattcctaatctgccctacttaatcgatgggtcacacaagatcacccagagcaat
gccatcctgcgctaccttggccggaagcacaacctgtgtggagagacagaagaagagaga
ctccgtgtggacattttggagaaccaggccgtggacactcgtaggcagctttcaatggtc
tgctacagccctgagtttgagaaacggaagccagagtacttagagggtctccctgacaag
atgaagctctactctgagttcctgggcaagcagctatggtttgcagggaacaagattacc
tatgtggatttccttgtttatgatgtcctcgataagcaccgtatgtttgagctcaagtgc
ctggacgcctttccaaatctgaaggacttcatggctcgatttgagacccttgagaagatc
tctgcctacatgaagtccagccgcttcctttcaggccctgtgtatttgaagacagcgctg
tggggtaacaagtag

KEGG   Rattus norvegicus (rat): 300850
Entry
300850            CDS       T01003                                 

Gene name
Gsta4
Definition
(RefSeq) glutathione S-transferase alpha-4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    300850 (Gsta4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    300850 (Gsta4)
   00982 Drug metabolism - cytochrome P450
    300850 (Gsta4)
   00983 Drug metabolism - other enzymes
    300850 (Gsta4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    300850 (Gsta4)
   05204 Chemical carcinogenesis - DNA adducts
    300850 (Gsta4)
   05207 Chemical carcinogenesis - receptor activation
    300850 (Gsta4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    300850 (Gsta4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    300850 (Gsta4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    300850 (Gsta4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    300850 (Gsta4)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     300850 (Gsta4)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   300850 (Gsta4)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3 GST_C_2
Other DBs
NCBI-GeneID: 300850
NCBI-ProteinID: NP_001100310
RGD: 1309970
Ensembl: ENSRNOG00000030449
UniProt: P14942 A9UMW1
Position
8
AA seq 222 aa
MEVKPKLYYFQGRGRMESIRWLLATAGVEFEEEFLETREQYEKLQKDGCLLFGQVPLVEI
DGMLLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIIGAPFKAPQEKEES
LALAVKRAKNRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEEVSAPVLSDFPL
LQAFKTRISNIPTIKKFLQPGSQRKPPPDGHYVDVVRTVLKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggaagtcaaacccaagctctactactttcaaggcaggggaaggatggagtcgatccgc
tggctgctggctacagctggagtggagtttgaagaagaatttcttgagacgagagaacaa
tatgagaagttgcaaaaggatggatgcctgctttttggccaagtcccattggtggaaata
gacgggatgctactgacacagaccagagccatcctcagctacctggccgccaagtacaac
ttgtatgggaaggacctgaaggagagagtcaggattgacatgtatgccgatggcacccag
gacctgatgatgatgattatcggggctccatttaaagcccctcaggaaaaagaagagagc
ctagctttagcagtgaagagggctaaaaaccgttacttcccagtgtttgaaaagatttta
aaagaccatggagaggcatttcttgttggcaaccaactcagttgggcagacatacagcta
ctagaagccattttgatggtggaagaagtcagtgctcctgtgttgtctgacttccctctg
ctgcaggcatttaagacaagaatcagcaacattcctacaattaagaagttcctgcaacct
ggaagtcagaggaagccacctccggatggccactatgttgacgtggtcaggaccgtcctg
aagttctag

KEGG   Rattus norvegicus (rat): 309465
Entry
309465            CDS       T01003                                 

Gene name
Gsto2
Definition
(RefSeq) glutathione S-transferase omega-2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    309465 (Gsto2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    309465 (Gsto2)
   00982 Drug metabolism - cytochrome P450
    309465 (Gsto2)
   00983 Drug metabolism - other enzymes
    309465 (Gsto2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    309465 (Gsto2)
   05204 Chemical carcinogenesis - DNA adducts
    309465 (Gsto2)
   05207 Chemical carcinogenesis - receptor activation
    309465 (Gsto2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    309465 (Gsto2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    309465 (Gsto2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    309465 (Gsto2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    309465 (Gsto2)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     309465 (Gsto2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   309465 (Gsto2)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Other DBs
NCBI-GeneID: 309465
NCBI-ProteinID: NP_001012071
RGD: 1310764
Ensembl: ENSRNOG00000012801
Vega: OTTRNOG00000000846
UniProt: Q6AXV9 B6DYQ6
Position
1
AA seq 248 aa
MSGDLTRCLGKGSCPPGPVPEGVIRIYSMRFCPYSHRTRLVLKAKSIRHEIININLKNKP
DWYYTKHPFGQVPVLENSQCQLIYESVIACEYLDDVFPGRKLFPYDPYERARQKMLLELF
CKVPQLSKECLVALRCGRDCTDLKVALRQELCNLEEILEYQNTTFFGGDSISMIDYLVWP
WFERLDVYGLADCVNHTPMLRLWISSMKQDPAVCALHIDKNIFLGFLNLYFQNNPCAFDF
GLCGPIVR
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtctggggatttgacaagatgcttggggaaaggaagctgtcccccagggccggtccct
gagggtgtgatccgaatctacagcatgaggttctgcccctactcgcacaggacacgcctg
gtcctcaaggccaaaagcatcaggcatgaaatcatcaacattaacctgaaaaacaagcct
gattggtactatacaaaacacccttttggccaggttcctgtcctggagaacagccaatgt
cagctgatctatgaatccgtcattgcgtgtgagtacctggatgacgtcttcccaggaagg
aagctgtttccatacgacccatatgaacgagctcgccagaagatgttattggagctattc
tgtaaggtcccacagttaagcaaggaatgtctggtagcgctgagatgtgggagagactgt
acggatctgaaggttgccctgcgtcaggagttgtgcaatctggaagagattcttgaatat
cagaacactaccttcttcggtggagactctatatccatgattgattacctcgtctggccc
tggtttgagcgactggatgtatatggactggctgactgtgtgaatcacaccccaatgctg
cggctctggatatcctccatgaagcaggaccccgcagtgtgcgctctgcacattgataag
aacattttcctgggcttcttgaatctctatttccaaaacaacccttgtgcctttgatttt
gggctgtgtggcccaatcgtacggtaa

KEGG   Rattus norvegicus (rat): 363205
Entry
363205            CDS       T01003                                 

Gene name
RGD1562107
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    363205 (RGD1562107)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    363205 (RGD1562107)
   00982 Drug metabolism - cytochrome P450
    363205 (RGD1562107)
   00983 Drug metabolism - other enzymes
    363205 (RGD1562107)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    363205 (RGD1562107)
   05204 Chemical carcinogenesis - DNA adducts
    363205 (RGD1562107)
   05207 Chemical carcinogenesis - receptor activation
    363205 (RGD1562107)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    363205 (RGD1562107)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    363205 (RGD1562107)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    363205 (RGD1562107)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    363205 (RGD1562107)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     363205 (RGD1562107)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   363205 (RGD1562107)
SSDB
Motif
Pfam: GST_N GST_N_3
Other DBs
NCBI-GeneID: 363205
NCBI-ProteinID: XP_343546
RGD: 1562107
Ensembl: ENSRNOG00000024755
Position
9
AA seq 152 aa
MAGKPVLHYFNGRGRMESVRWLLAAAGVEFEEELFETREEFEKLLQGGTLMYEQVPMVEI
DGMNLVQTRAILRYVAAKYDLYGRNQEEQAWIDMYVEGLRDLSDMIMYFPLSLPEEKEMN
LEYILQRATTRFFPVYEKVSHDLQLESKREDG
NT seq 459 nt   +upstreamnt  +downstreamnt
atggctgggaagcctgtgcttcattacttcaatggaaggggaagaatggagtcagtccgg
tggctcctggcagcagctggagtagagtttgaggaggaactttttgaaacccgtgaagaa
tttgagaagttactccaaggtggaaccctgatgtatgaacaagtgcccatggtggaaatc
gatggaatgaatttggtgcagaccagagccatcttaagatatgtagctgcaaagtatgac
ttgtacggaaggaaccaggaagagcaagcctggattgatatgtacgtagaaggcttgagg
gacctgagcgacatgataatgtacttcccgctctctctgccggaagagaaggagatgaac
ctggagtacatcctccaaagagccacaacaagattcttcccggtttacgagaaggtgagc
catgaccttcagctcgaatcaaagagagaggacggctaa

KEGG   Rattus norvegicus (rat): 494499
Entry
494499            CDS       T01003                                 

Gene name
Gsta5
Definition
(RefSeq) glutathione S-transferase alpha-2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    494499 (Gsta5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    494499 (Gsta5)
   00982 Drug metabolism - cytochrome P450
    494499 (Gsta5)
   00983 Drug metabolism - other enzymes
    494499 (Gsta5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    494499 (Gsta5)
   05204 Chemical carcinogenesis - DNA adducts
    494499 (Gsta5)
   05207 Chemical carcinogenesis - receptor activation
    494499 (Gsta5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    494499 (Gsta5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    494499 (Gsta5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    494499 (Gsta5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    494499 (Gsta5)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     494499 (Gsta5)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   494499 (Gsta5)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Other DBs
NCBI-GeneID: 494499
NCBI-ProteinID: NP_001010921
RGD: 1593189
Ensembl: ENSRNOG00000000201
UniProt: P04903 Q4FZZ3
Position
8
AA seq 222 aa
MSGKPVLHYFNARGRMECIRWLLAAAGVEFEEKLIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIIQLVICPPDQREAK
TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTPFPL
LKAFKSRISSLPNVKKFLQPGSQRKPAMDAKQIEEARKVFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtctgggaagccagtgcttcactacttcaatgcccggggcagaatggagtgcatccgg
tggctcctggctgcagcaggagtggagtttgaagagaagcttatacagagtccagaagac
ttggaaaagctaaagaaagacgggaatttgatgtttgaccaagtgcccatggtggagatt
gacgggatgaagctggcacagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtattcagagggtatttta
gatctgactgaaatgattatccaattggtaatatgtcccccagaccaaagagaagccaag
accgccttggcaaaagacaggaccaaaaaccggtacttgcctgcctttgaaaaggtgttg
aagagccatggccaagactaccttgtaggcaacaggctgacccgggtagacatccacctg
ctggaacttctcctctatgttgaagagtttgatgccagccttctgacccctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctgcagcct
ggcagtcagagaaagccagccatggatgcaaaacaaatcgaagaagcaaggaaggttttc
aagttttag

KEGG   Rattus norvegicus (rat): 494500
Entry
494500            CDS       T01003                                 

Gene name
Gsta3
Definition
(RefSeq) glutathione S-transferase alpha-5 isoform 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    494500 (Gsta3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    494500 (Gsta3)
   00982 Drug metabolism - cytochrome P450
    494500 (Gsta3)
   00983 Drug metabolism - other enzymes
    494500 (Gsta3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    494500 (Gsta3)
   05204 Chemical carcinogenesis - DNA adducts
    494500 (Gsta3)
   05207 Chemical carcinogenesis - receptor activation
    494500 (Gsta3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    494500 (Gsta3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    494500 (Gsta3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    494500 (Gsta3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    494500 (Gsta3)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     494500 (Gsta3)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   494500 (Gsta3)
SSDB
Motif
Pfam: GST_C GST_C_3 GST_N
Other DBs
NCBI-GeneID: 494500
NCBI-ProteinID: NP_001009920
RGD: 1591980
Ensembl: ENSRNOG00000056847
UniProt: P46418
Position
9
AA seq 221 aa
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEI
DGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEAS
LAKIKDKARNRYFPAYEKVLKSHGQDYLVGNKLSRADVSLVELLYHVEEMDPGIVDNFPL
LKALRTRVSNLPTVKKFLQPGSQRKPFDDEKCVESAKKIFS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgccggggaagccagtccttcactacttcgatggcagggggagaatggagcccatccgg
tggctcctggctgcagctggagtagagtttgaagaaaattttctgaaaactcgggatgac
ctggccaggttaagaagtgatgggagtttgatgtttgaacaagtgcccatggtggagatt
gacgggatgaagctggtgcagaccaaagccattctcaactacattgccaccaaatacaac
ctctatgggaaggacatgaaggagagagccctcatcgacatgtatgcagaaggtgtggcc
gatctggagttgatggttctctattacccctacatgccccctggggagaaagaggcgagt
cttgccaagatcaaggacaaagcaaggaaccgttacttccctgcctatgagaaggtgttg
aagagccacggacaagattatctcgttggcaacaagctgagcagggctgatgtttccctg
gttgaacttctctaccatgtggaagagatggacccaggcattgtggacaacttccctctg
ctaaaggccctgagaaccagagtcagcaacctccccacagtgaagaaatttcttcagcct
ggcagccagaggaagccttttgatgatgagaaatgtgtagaatcagcgaagaagatcttc
agttaa

KEGG   Rattus norvegicus (rat): 499422
Entry
499422            CDS       T01003                                 

Gene name
Gstt3
Definition
(RefSeq) glutathione S-transferase, theta 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    499422 (Gstt3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    499422 (Gstt3)
   00982 Drug metabolism - cytochrome P450
    499422 (Gstt3)
   00983 Drug metabolism - other enzymes
    499422 (Gstt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    499422 (Gstt3)
   05204 Chemical carcinogenesis - DNA adducts
    499422 (Gstt3)
   05207 Chemical carcinogenesis - receptor activation
    499422 (Gstt3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    499422 (Gstt3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    499422 (Gstt3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    499422 (Gstt3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    499422 (Gstt3)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     499422 (Gstt3)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   499422 (Gstt3)
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_N_4 Glutaredoxin
Other DBs
NCBI-GeneID: 499422
NCBI-ProteinID: NP_001131115
RGD: 1562732
Ensembl: ENSRNOG00000001242
UniProt: D3Z8I7
Position
20
AA seq 210 aa
MGGKTGIELRSRLRSTEGLRPSRSCSPLQLLLPLSTEAVHPRPISEVCQRLLPTASAMGL
ELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFV
LAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKVTCQCW
LQNLREPTQTGCVASAGGSRSGGEPLPGGP
NT seq 633 nt   +upstreamnt  +downstreamnt
atgggagggaagactgggatcgagctccgatcgaggctaagaagcactgaaggactaaga
cccagccgttcctgctcgccgttgcagctgcttctgcctctgtccaccgaggcagttcac
ccgaggccgatctccgaggtctgccagcggctacttcccacagcctccgccatgggtctg
gagctctacctggacctgatgtcccagccctgccgtgccgtctacatcttcgccaagaag
aacggcatccccttccagctgcgtaccatcgagctgcttaaaggtcagcattacactgat
gcctttgcccaggtgaaccctttgaggaaggtgccggctttgaaggatggggacttcgtc
ttggcagagagtgtggccatcttgctgtatttgagtagaaagtacaaggcacctgaccac
tggtaccctcaggacctacagacccgagctcgtgtggatgagtacctggcttggcagcac
acagccctgcggagctgttgcagcagggccatgtggcagaaggtgacctgtcagtgctgg
ctgcaaaatcttcgagagccgacccaaactggctgcgtggcgtcagcgggtggaagccgc
agtgggggagagcctcttccaggaggcccatga

KEGG   Rattus norvegicus (rat): 499688
Entry
499688            CDS       T01003                                 

Gene name
Gstm6
Definition
(RefSeq) glutathione S-transferase Mu 6
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    499688 (Gstm6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    499688 (Gstm6)
   00982 Drug metabolism - cytochrome P450
    499688 (Gstm6)
   00983 Drug metabolism - other enzymes
    499688 (Gstm6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    499688 (Gstm6)
   05204 Chemical carcinogenesis - DNA adducts
    499688 (Gstm6)
   05207 Chemical carcinogenesis - receptor activation
    499688 (Gstm6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    499688 (Gstm6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    499688 (Gstm6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    499688 (Gstm6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    499688 (Gstm6)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     499688 (Gstm6)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   499688 (Gstm6)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 499688
NCBI-ProteinID: NP_001102662
RGD: 1563391
Ensembl: ENSRNOG00000019017
UniProt: B0BN47
Position
2
AA seq 218 aa
MPVTLGYWDIRGLGHAIRLLLEYTETSYEEKRYAMGDAPDYDRSQWLDDKFKLDLDFPNL
PYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDILEKQVMDTRIQMGTLCYSPDF
EKRKPEFLKGLPDQLKLYSEFLGKQPWFAGDKITFADFLVYDVLDQHRMFEPKCLDAFPN
LMDFVVHFEGLKKISAYMKTSRFLPSPVYLKQATWGNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcccgtgactcttggttattgggatatccgcggattgggtcacgccatccggctgctc
ctggaatacacagaaacaagctatgaggagaagagatacgccatgggcgacgctcccgac
tatgacagaagccagtggctggatgacaaattcaagctggatctggacttccccaatctg
ccctacttaattgatgggtcacacaaggtcacccagagcaatgccatcctgcgctacctt
ggccggaagcacaacctgtgtggggagacagaggaggagaggattcgtgtggacattttg
gagaaacaggtcatggacacccgcattcagatgggcacactctgctacagccctgacttc
gagaaacggaagcctgagttcttgaagggcctcccagatcagctgaagctctactccgag
ttcctggggaagcagccatggtttgcaggggacaagatcacctttgcagatttccttgtc
tatgatgtccttgaccagcaccgaatgtttgaacccaagtgcctggacgccttcccaaac
ctgatggacttcgtggtccactttgagggcctgaagaagatctctgcctatatgaagacc
agccgcttccttccaagtcctgtgtacttaaaacaggccacgtggggcaacaagtag

KEGG   Rattus norvegicus (rat): 499689
Entry
499689            CDS       T01003                                 

Gene name
Gstm4
Definition
(RefSeq) glutathione S-transferase Mu 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    499689 (Gstm4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    499689 (Gstm4)
   00982 Drug metabolism - cytochrome P450
    499689 (Gstm4)
   00983 Drug metabolism - other enzymes
    499689 (Gstm4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    499689 (Gstm4)
   05204 Chemical carcinogenesis - DNA adducts
    499689 (Gstm4)
   05207 Chemical carcinogenesis - receptor activation
    499689 (Gstm4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    499689 (Gstm4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    499689 (Gstm4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    499689 (Gstm4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    499689 (Gstm4)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     499689 (Gstm4)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   499689 (Gstm4)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_N_3 GST_C_2 Bromo_TP
Other DBs
NCBI-GeneID: 499689
NCBI-ProteinID: NP_001019475
RGD: 1565825
Ensembl: ENSRNOG00000019221
UniProt: Q5BK56
Position
2
AA seq 218 aa
MPMTLGYWDIRGLAHAIRLLLEYTDSSYEEKRYTMGDAPDYDRSQWLSEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDF
ENLKAEYLEQLPGMMELFSQFLGKQTWFVGEKITFVDFLAYDILDLHLIFEPKCLDAFPN
LKDFVARFEGLKKISVYMKTSRFLRTPLYTRVATWGNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcctatgacactgggttactgggacatccgtgggctggctcatgctattcgattactc
ctggaatacacagactcaagctatgaggagaagagatacaccatgggcgacgctcctgac
tatgacagaagccagtggctgagtgagaagttcaaactgggcctggacttccccaatctg
ccctacttaatcgatgggtcacacaagatcacccagagcaatgccatcctgcgctatatt
gcccgaaagcacaacctgtgtggggagacagaagaagagaagattcgtgtggacattttg
gagaaccaggctatggatgtctccaatcagctggctagagtctgttacagcccagacttt
gagaacctgaaggcggaatatttggagcagctccctgggatgatggagctcttctcacag
ttcctggggaagcagacgtggttcgttggtgaaaagattacttttgtagatttccttgct
tatgatatcctggacctgcaccttatattcgaacccaagtgcctggatgccttcccaaac
ctgaaggactttgtggcccgcttcgagggactgaagaagatctctgtttacatgaagacc
agccgcttcctccggacacccctatatacaagggtggctacttggggcaataagtag

KEGG   Rattus norvegicus (rat): 501110
Entry
501110            CDS       T01003                                 

Gene name
Gsta6
Definition
(RefSeq) glutathione S-transferase A6
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    501110 (Gsta6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    501110 (Gsta6)
   00982 Drug metabolism - cytochrome P450
    501110 (Gsta6)
   00983 Drug metabolism - other enzymes
    501110 (Gsta6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    501110 (Gsta6)
   05204 Chemical carcinogenesis - DNA adducts
    501110 (Gsta6)
   05207 Chemical carcinogenesis - receptor activation
    501110 (Gsta6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    501110 (Gsta6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    501110 (Gsta6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    501110 (Gsta6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    501110 (Gsta6)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     501110 (Gsta6)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   501110 (Gsta6)
SSDB
Motif
Pfam: GST_C_3 GST_N GST_C GST_N_3
Other DBs
NCBI-GeneID: 501110
NCBI-ProteinID: NP_001019532
RGD: 1565402
Ensembl: ENSRNOG00000033402
UniProt: Q6AXY0
Position
9
AA seq 222 aa
MAEKPLFHYDEARGRMESVRWLLAAAGVEYEEKFIHTNEDLEKLRSDGVLMFQQVPMVEV
DGMKLVQTRAIMNYFSSKYNLYGKDMKERALIDMYSEGLADLNEMFILYPFDPPGVKEAN
IALMKEKATNRYFPAFEKVFESHGQDYLVGNKLSKADVHLVEMIYNMEELDTNILANFPL
LQALKTRISDMPTIKKFLQPGSQRQPPVDEKSIQKTRKIFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcagagaagcctttatttcattatgatgaggcccggggtagaatggagtctgtgcgg
tggctattggctgcagctggagtagagtatgaagagaagtttatacacactaatgaagac
ttggagaagttaagaagtgatggagttctgatgttccagcaagtgcccatggtggaggtt
gatgggatgaagctggtgcagaccagagccattatgaactatttttccagcaaatacaat
ctctatgggaaggacatgaaggagagagccctcatcgatatgtattcggaagggttggca
gatttgaatgagatgtttattctctacccatttgacccacctggagtcaaagaagcaaat
atcgccctgatgaaagagaaagcaacaaaccgttactttcctgcctttgaaaaggtgttt
gagagtcatggacaggactacctcgttgggaacaagctaagcaaggctgatgttcacctg
gttgaaatgatctacaatatggaagaactagataccaacattttagccaactttcctcta
ctgcaggctctgaaaacccgaatcagcgacatgcccaccataaagaagtttctgcagcct
ggcagccaaaggcagcctcctgttgatgagaaaagtatacaaaagacaaggaagattttc
aagttttaa

KEGG   Rattus norvegicus (rat): 57298
Entry
57298             CDS       T01003                                 

Gene name
Gstm3l
Definition
(RefSeq) glutathione S-transferase Mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    57298 (Gstm3l)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    57298 (Gstm3l)
   00982 Drug metabolism - cytochrome P450
    57298 (Gstm3l)
   00983 Drug metabolism - other enzymes
    57298 (Gstm3l)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    57298 (Gstm3l)
   05204 Chemical carcinogenesis - DNA adducts
    57298 (Gstm3l)
   05207 Chemical carcinogenesis - receptor activation
    57298 (Gstm3l)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    57298 (Gstm3l)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    57298 (Gstm3l)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    57298 (Gstm3l)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    57298 (Gstm3l)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     57298 (Gstm3l)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   57298 (Gstm3l)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 57298
NCBI-ProteinID: NP_065415
RGD: 620381
Ensembl: ENSRNOG00000019058
UniProt: Q9WU21
Position
2
AA seq 218 aa
MAMILGYWNVRGLTHPIRLLLEYTDSNYEEKRYVMGDAPNFDRSQWLSEKFNLGLDIPNL
PYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRIHLMIVCCSPDF
EKQKPEFLKSIPEKMKIYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPECLDAFPN
LKDFLARFEGLKKISAYMKSSSFLPRPVFTKIPQWGTD
NT seq 657 nt   +upstreamnt  +downstreamnt
atggctatgatactgggatattggaacgttcgcggacttactcaccccatccgcctgctc
ctggaatacacagattcaaactatgaggagaagagatacgtcatgggggatgcccccaac
tttgacagaagccagtggctgagtgagaaattcaatcttggcctggacattcccaatttg
ccctacttaattgatgggtcacacaaggtcacccagagcaatgccatcctgcgctacctt
ggccggaagcacaacctgtgtggggagacagaggaggagaggattcgtgtggacactttg
gagaaccaggtcatggacacccgcatacatctcatgatagtttgctgcagtcctgacttt
gagaagcagaagccagagttcttgaagtccatcccggagaagatgaaaatctattcagag
ttcctgggcaagcgaccatggtttgcaggggacaaggtcacctatgtggatttccttgct
tatgacattcttgaccagtaccgtatgtttgagcccgagtgcctggacgccttcccaaac
ctgaaggacttcctggcccgcttcgagggcctgaagaagatctctgcttacatgaagagt
agcagctttctcccaagacctgtgtttactaagataccgcagtggggcactgattag

KEGG   Rattus norvegicus (rat): 64352
Entry
64352             CDS       T01003                                 

Gene name
Gstm5
Definition
(RefSeq) glutathione S-transferase Mu 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    64352 (Gstm5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    64352 (Gstm5)
   00982 Drug metabolism - cytochrome P450
    64352 (Gstm5)
   00983 Drug metabolism - other enzymes
    64352 (Gstm5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64352 (Gstm5)
   05204 Chemical carcinogenesis - DNA adducts
    64352 (Gstm5)
   05207 Chemical carcinogenesis - receptor activation
    64352 (Gstm5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    64352 (Gstm5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    64352 (Gstm5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    64352 (Gstm5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    64352 (Gstm5)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     64352 (Gstm5)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   64352 (Gstm5)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3 GST_C_6
Other DBs
NCBI-GeneID: 64352
NCBI-ProteinID: NP_742035
RGD: 61964
Ensembl: ENSRNOG00000058357
UniProt: Q9Z1B2
Position
2
AA seq 225 aa
MSCSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKQYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCY
NSNHESLKPQYLEQLPAQLKQFSLFLGKFTWFAGEKLTFVDFLTYDVLDQNRMFEPKCLD
EFPNLKAFMCRFEALEKIAAFLQSDRCFKMPINNKMAKWGNKSIC
NT seq 678 nt   +upstreamnt  +downstreamnt
atgtcgtgctccaagtctatggttctgggttactgggatatccgcgggctggctcatgcc
atccgtatgctcctggagtttactgataccagctatgaagagaaacagtacacgtgtggg
gaagctcctgactatgatagaagccaatggctggacgtgaaattcaagctagatctggat
tttcctaacctgccctaccttatggacgggaagaacaagatcacccagagtaacgccatc
ttgcggtacatcgcacgcaagcacaacatgtgtggtgacaccgaagaagaaaagattcga
gtggacatcatggagaaccagataatggacttccgcatgcagctggttcggctctgctac
aattctaaccacgaaagcctgaagcctcagtatttggaacaactgcctgcacagctgaaa
cagttctcgttgttcctggggaaattcacatggtttgcaggagaaaagctgaccttcgtg
gattttctcacttatgacgtcttggaccagaatcgtatgtttgagcccaagtgcctggat
gagttcccaaatctgaaggctttcatgtgccgttttgaggctttggagaagattgctgca
ttcctgcagtctgaccgctgcttcaagatgccaatcaacaacaagatggccaagtggggt
aacaagagcatatgctga

KEGG   Rattus norvegicus (rat): 686922
Entry
686922            CDS       T01003                                 

Gene name
Gstt4
Definition
(RefSeq) glutathione S-transferase theta-4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    686922 (Gstt4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    686922 (Gstt4)
   00982 Drug metabolism - cytochrome P450
    686922 (Gstt4)
   00983 Drug metabolism - other enzymes
    686922 (Gstt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    686922 (Gstt4)
   05204 Chemical carcinogenesis - DNA adducts
    686922 (Gstt4)
   05207 Chemical carcinogenesis - receptor activation
    686922 (Gstt4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    686922 (Gstt4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    686922 (Gstt4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    686922 (Gstt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    686922 (Gstt4)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     686922 (Gstt4)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   686922 (Gstt4)
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C Glutaredoxin GST_C_3 DUF6279 GST_C_2
Other DBs
NCBI-GeneID: 686922
NCBI-ProteinID: NP_001103145
RGD: 1591294
Ensembl: ENSRNOG00000038300
UniProt: Q4V8E6
Position
20
AA seq 240 aa
MGLELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSLRDG
KFILSESVAILCYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLII
PMITGEEVPTERLDKTLDEVNKNIKQFEEKFLQDKLFITGDHISLADLVALVEMMQPMGT
NHNVFISSKLAEWRMRVELAIGSGLFWEAHDRLVKLPSWDCSTLDPSIKMKICEFLQKYK
NT seq 723 nt   +upstreamnt  +downstreamnt
atgggcctggagctctacatggacttgctgtcagcaccttgccgcgccgtctacatcttt
gccaggaagaatggcatcccctttgacttccagtttgtggatctattaaaaggtcaccat
catagcaaggaatacatcgaaatcaaccccttgaggaaggttcccagcctcagagatggc
aagttcatcttatctgaaagcgtggctatcctctgctacctatgccgaaagtacagcgcg
ccttctcactggtatccgccagacctgcacatgcgtgcccgtgtggacgagttcatggcg
tggcagcatacagctattcaggtgcccatgagtaagatactgtggatcaagttgataatt
ccaatgatcacgggtgaggaggttcctaccgagaggttagacaagacactggatgaggtg
aacaagaacataaaacaatttgaggagaagtttctgcaggacaagttgttcatcactggg
gaccatatctcactggccgacttggtggcactggtggagatgatgcagccaatgggaact
aaccacaatgtcttcatcagctccaagcttgcagaatggagaatgcgggtggagttagcc
atcggttctggcctcttctgggaggctcatgacagactggtgaagttgccaagctgggac
tgttcgacactggacccttcgatcaagatgaagatctgtgagtttctgcagaagtataag
tga

KEGG   Rattus norvegicus (rat): 81869
Entry
81869             CDS       T01003                                 

Gene name
Gstm7
Definition
(RefSeq) glutathione S-transferase Mu 7
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    81869 (Gstm7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    81869 (Gstm7)
   00982 Drug metabolism - cytochrome P450
    81869 (Gstm7)
   00983 Drug metabolism - other enzymes
    81869 (Gstm7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81869 (Gstm7)
   05204 Chemical carcinogenesis - DNA adducts
    81869 (Gstm7)
   05207 Chemical carcinogenesis - receptor activation
    81869 (Gstm7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    81869 (Gstm7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    81869 (Gstm7)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    81869 (Gstm7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    81869 (Gstm7)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     81869 (Gstm7)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   81869 (Gstm7)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_N_3 GST_C_2 Bromo_TP GST_N_2
Other DBs
NCBI-GeneID: 81869
NCBI-ProteinID: NP_112416
RGD: 621287
Ensembl: ENSRNOG00000018937
UniProt: P08009
Position
2
AA seq 218 aa
MPMTLGYWDIRGLAHAIRLLLEYTDSSYEEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNPDF
EKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEATCLDAFPN
LKDFIARFEGLKKISDYMKSSRFLPRPLFTKMAIWGSK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcccatgacactgggttactgggacatccgtgggctagcgcatgccatccgcctgctc
ctggaatacacagactcgagctatgaggagaagagatacaccatgggagacgctcccgac
tttgacagaagccagtggctgaatgagaagttcaaactgggcctggacttccccaatctg
ccctacttaattgatgggtcacacaagatcacccagagcaacgccatcctgcgctatctt
ggccgcaagcacaacctgtgtggggagacagaagaggagaggattcgtgtggacattctg
gagaatcagctcatggacaaccgcatggtgctggcgagactttgctataaccctgacttt
gagaagctgaagccagggtacctggagcaactgcctggaatgatgcggctttactccgag
ttcctgggcaagcggccatggtttgcaggggacaagatcacctttgtggatttcattgct
tacgatgttcttgagaggaaccaagtgtttgaggccacgtgcctggacgcgttcccaaac
ctgaaggatttcatagcgcgctttgagggcctgaagaagatctccgactacatgaagtcc
agccgcttcctcccaagacctctgttcacaaagatggctatttggggcagcaagtag

DBGET integrated database retrieval system