KEGG   Rattus norvegicus (rat): 103691373
Entry
103691373         CDS       T01003                                 

Gene name
Frat1
Definition
(RefSeq) proto-oncogene FRAT1
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05200  Pathways in cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103691373 (Frat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103691373 (Frat1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103691373 (Frat1)
   05226 Gastric cancer
    103691373 (Frat1)
   05224 Breast cancer
    103691373 (Frat1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103691373 (Frat1)
   05022 Pathways of neurodegeneration - multiple diseases
    103691373 (Frat1)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 103691373
NCBI-ProteinID: XP_017445974
RGD: 9147096
Position
1
AA seq 273 aa
MPCRREEEEEAGDEAEGEEDDDSFLLLQQSVTLGGSTDVDRLIAQIGETLQLDAAHDGPA
SPRAAPGPPPAPPVLAALPADKAGAPARLLRPATSGEAGDPAPPGAVRCVLGERGRVRGR
AAPYCVAEIAPGASALPQQPGFDGPPGTGKLNTPQPLSGPCRRGWLRNAAASRRLPQRRG
SQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLHAKLPAHPFLGPLSAPVHEP
PSPQSPRAACSDPGACVRRAQLRTGDDLLVPGS
NT seq 822 nt   +upstreamnt  +downstreamnt
atgccttgccggagggaggaggaggaggaagccggcgatgaggcggagggggaggaggac
gacgacagtttcctcctgctgcagcagtcggtgactctgggcggctcgaccgacgtggac
cggctcatcgcccagatcggcgagacgctgcagctggacgcggcgcacgacggtccggcc
tcgccgcgtgcggccccgggtcccccgcccgcgcccccggtcctggcggcgctgcccgca
gacaaggccggggccccggcgaggctgctgcggccggcgacatcaggggaggccggagac
cctgcgcccccgggggcggtgcgctgcgtgctgggggagcgcgggcgcgtgcggggccgg
gcggcgccctactgcgtggcggagatcgccccgggcgccagcgctctgccccagcagccg
ggctttgacggacccccagggaccggcaaactaaacaccccgcagccactgtccggcccg
tgccggcgaggttggctccggaacgcagccgcgtcccgccgcctgccacagcgacgcgga
tctcagccggagacccgcaccggcgacgacgacccgcaccgactcctgcagcagctcgtg
ctctcggggaacctcatcaaggaggcggtgcggagacttcattcgcgacggctacagcta
cacgcaaagcttcccgcacacccgttcctcgggcccctgtcagccccggtgcatgagccg
ccttcgccccagagccctcgcgcggcctgcagcgaccctggcgcttgcgtgaggagggcg
cagctcagaactggggacgaccttcttgtccctggcagctaa

KEGG   Rattus norvegicus (rat): 308692
Entry
308692            CDS       T01003                                 

Gene name
Peg12
Definition
(RefSeq) paternally expressed 12
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05200  Pathways in cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    308692 (Peg12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    308692 (Peg12)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    308692 (Peg12)
   05226 Gastric cancer
    308692 (Peg12)
   05224 Breast cancer
    308692 (Peg12)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    308692 (Peg12)
   05022 Pathways of neurodegeneration - multiple diseases
    308692 (Peg12)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 308692
NCBI-ProteinID: NP_001164033
RGD: 1307664
Ensembl: ENSRNOG00000024429
UniProt: D3Z8R0
Position
1
AA seq 274 aa
MPCLREEEEASDQADGEEDNDSFLLLQQSVTLGGSADVDQLIARIGETLQLDTAHDSPAS
QCAAPGPPPAPPRVLAALPADKARAPTRRLLRLAASPETWDPAPPGAMRCVLGERGRVRD
RAAPYSVAEIAPGPSVLPQQQGLEGPQGTGKLSIPQPLSGPCRRGWLRNTAASRRLQQRR
GSHLETRTGEDDPPRLLQQLLLSGNLIKEAVRRLHSRRLQLQAKLPAHPFLEPLSAPVHE
PLSPGSPRAACSDPGACVRRAQLRNGDDLLVSGS
NT seq 825 nt   +upstreamnt  +downstreamnt
atgccgtgcctgagggaggaggaggaagcgagcgaccaggcggatggggaggaggacaac
gacagcttcctcctgctgcagcagtcggtgactctgggcggctcggcagacgtggaccaa
ctcatcgcccggatcggcgagacgctgcagctggacacggcgcacgacagtcccgcctcg
cagtgtgcggccccgggccccccaccagcgcccccgcgggtcctggcggcgctgccggcg
gacaaagccagggccccaacgaggcggctgctgcggctggcagcttcaccggaaacctgg
gaccctgcgccccccggggccatgcgctgtgtgctgggggagcgcgggcgcgtgcgggac
cgggcagcgccctacagcgtggcagagatcgccccgggccccagcgtgctgccccagcag
cagggccttgagggaccccagggaaccggcaaattaagcatcccacagccactgtctggc
ccgtgccggcggggttggctccggaacacagccgcgtcccgccgcctgcaacagcgacgc
ggatctcatctggagacccgcactggcgaagacgacccgccccggctcctgcagcagctc
ttactttcgggaaacctcatcaaggaggcggtgcggagacttcattcacgaaggctacag
ctacaggcgaagcttcccgcacacccgttcttggagcctctgtcagccccagtgcatgag
ccactttcacccgggagccctcgcgcggcctgcagcgaccctggcgcttgtgtgaggagg
gcgcagctcagaaatggggacgaccttcttgtctctggcagctaa

KEGG   Rattus norvegicus (rat): 679110
Entry
679110            CDS       T01003                                 

Gene name
Frat2
Definition
(RefSeq) GSK-3-binding protein FRAT2
  KO
K03096  frequently rearranged in advanced T-cell lymphomas 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05200  Pathways in cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    679110 (Frat2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    679110 (Frat2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    679110 (Frat2)
   05226 Gastric cancer
    679110 (Frat2)
   05224 Breast cancer
    679110 (Frat2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    679110 (Frat2)
   05022 Pathways of neurodegeneration - multiple diseases
    679110 (Frat2)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 679110
NCBI-ProteinID: XP_017445870
RGD: 1591882
Ensembl: ENSRNOG00000045543
UniProt: M0R5Z2
Position
1
AA seq 230 aa
MPCRREEEEEEAGDEAEGEEDDDSFLLLQQSVTLGGSTDVDRLIAQIGETLQLDAAHDSP
ASPCAAPGPPPAPPVLAALPADKVGGPARLLRPAASAEAGDPAPPGAVRCVLGERGRVRG
RAAPYCVAEIAPGASALPRPGRRGWLPGALASRRIQQRRCTASGSRAADDDPHRLLQQLV
LSGNLIKEAVRRLQRAVAAVAATSPASAPGSGGGRSGPDSVTLQPSGSWL
NT seq 693 nt   +upstreamnt  +downstreamnt
atgccgtgccggagggaggaggaggaggaggaagccggcgacgaggcggagggggaggag
gacgacgacagcttcctcctgctgcagcagtcggtgactctgggcggctcgaccgacgtg
gaccggctcatcgcccagatcggcgagacgctgcagctggacgcggcgcacgatagtccg
gcctcgccgtgtgccgccccgggtcccccacccgcgcccccggtcctggcggcgctgccg
gcggacaaggtcgggggcccagcgaggctgctgcggccggcagcatcagcggaggccgga
gaccctgcgcccccgggggcggtgcgctgcgtgctgggggagcgcgggcgggtgcggggc
cgggcggcgccctactgcgtggcagagatcgccccgggcgccagcgcgctgccccggcct
gggcggcgagggtggctccccggcgccttggcttctcggagaatccagcagcggcggtgt
accgcaagcggatcgcgcgcagcggacgacgaccctcaccggctcctgcagcagctcgtg
ctctccggaaacctcatcaaggaggcggtgcgcaggctccagcgagcggtcgccgcggtt
gcggccacgagccccgcgagcgccccgggttccgggggtggccgaagtggaccggactca
gtcaccctgcagccctcgggctcctggctctga

DBGET integrated database retrieval system