KEGG   Rattus norvegicus (rat): 103694328
Entry
103694328         CDS       T01003                                 

Definition
(RefSeq) ataxin-1-like
  KO
K23616  ataxin 1/1L
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103694328
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103694328
   05022 Pathways of neurodegeneration - multiple diseases
    103694328
SSDB
Motif
Pfam: AXH ATXN-1_C
Other DBs
NCBI-GeneID: 103694328
NCBI-ProteinID: XP_008770785
RGD: 9319286
Ensembl: ENSRNOG00000038766
UniProt: D3ZBC4
Position
19
AA seq 679 aa
MKPVHERSQECLPPKKRDLPVTSCSTNHTPSSDASEWSRGVVVAGQSQTGARVSLGGDGT
EAITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTFNVASSLIQHPGIHYPPVH
YAQLPSTSLQFIGSPYSLPYAVPPNFLPNPLLSPSANLATTHLPHFVPYASLLAEEAAPP
PQAASPAQSFTKSSSATSPPGQLPHHSNTQPLDLAPGRMPIYYQTSRLPAGYTLHETSTA
GASPILTPQEGQSALEAAAANGQRQRERSVRRESEPLDSTSSKGESQGLVPVVECMVDGQ
LFSGSQTPRVEVAAPTHRGTPDTDLEVQRVVGALASQDYRVVAAQRKDEPSPLNLSHHTL
DHQGEGRGSARNPTEVVEKNQTRVFYPQSHQEPVKHRPLPKAVVVANGNLVPTGTDPSLL
PVGSEILVASSLDMQARATFPDKEPTPPPVTSSHLPSHFMKGAIIQLATGELKRVEDLQT
QDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQ
GWSSCSPGRTAQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPGQLGTPRERPER
TILGPRDLCDSEGKNQTSGEGSRVGEPSQPEPSAQACWPAPSFQRYSMQGEEARAALLRP
SFIPQEVKLSIEGRSNAGK
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgaaacctgttcatgagcggagtcaggaatgccttccaccaaagaaacgagacctccct
gtgaccagctgctccacaaaccacacaccctccagtgatgcttctgagtggtcccgaggg
gttgtggtggctgggcagagccagacaggagccagagtcagcctcgggggtgatggaact
gaggccatcactggtctgacagtagatcagtatggcatgctgtacaaggtggccgtgcca
cctgccaccttctcaccgactggcctcccatctgttgtgaacatgagccccttacccccc
acatttaatgtagcatcttcactgattcaacatccaggaatccactatcccccagtccac
tatgctcagctcccatccacttcactgcagtttattgggtctccttacagccttccttat
gctgtgccacctaatttcctacccaatcctctcctttctccttctgccaaccttgccacc
actcaccttccacactttgtgccatatgcctccctcctagcagaagaggctgctcctccc
ccacaggctgcatccccagctcagtcatttaccaagtcctcttcggccacctccccaccc
ggccagttgccacatcactcgaatactcaaccactggatcttgctccaggccggatgccc
atttattatcagacatccaggctacctgctggatataccttgcatgaaacttccacagca
ggtgccagccccattcttacccctcaggagggccagtctgctctggaagcagctgctgcc
aatggacagagacaacgagagcgaagtgtaagacgagaaagtgagccccttgactccacc
agcagcaagggtgaaagccaaggactggtgccagtggtagaatgcatggtggatggacag
ttgttttcaggttctcagactccgagagtggaggtggcggcgccaacacatcgagggacc
ccagacaccgaccttgaggtccagcgggtagtcggcgctttagcttctcaggactatcgt
gtggtggcagctcagaggaaagatgaacccagccctcttaacctatcccatcataccctt
gaccatcagggtgagggacgagggtcagccaggaatcctacagaagtggtggagaaaaat
cagacccgtgtattctaccctcagtcccatcaggaaccagtaaaacacagacctttaccc
aaagcagtggttgtagccaatggcaacctggtgcccactggaactgaccctagcctgctg
cctgtgggctcagagatcctggtggcatcgagtctggacatgcaggccagagccactttc
ccagacaaggagccaacgccacctcccgttacctcctcccacttgccctcccatttcatg
aaaggcgccatcattcagttggctacgggggagctgaagcgggtagaggatctccaaacc
caggactttgtgcgtagtgccgaagtgagtggggggctgaagattgactctagcacagtc
gtggacattcaggagagccagtggcctggatttgttatgctgcatttcgtggttggtgaa
cagcagagtaaagtgagcatcgaggtgccccctgagcaccccttttttgtatatggccag
ggttggtcctcctgcagccctgggcggactgcacaactcttctctctgccctgccatcgg
ctacaggtgggagatgtctgcatctctatcagtttacagagcttgaacagtaactcagtt
tctcaggccagctgtgctcccccagggcagctgggtacaccccgagaaaggcctgagagg
acgatcttggggcccagagacctatgtgacagtgaggggaagaaccagacttcaggagag
ggttcccgggtgggagagccctcccagcctgagcctagtgctcaggcctgctggccagcc
ccaagcttccaaagatacagcatgcaaggggaggaggcacgggctgcgctgctccgcccc
tctttcattccgcaggaggtaaagctgtccatcgaagggcgttccaatgcaggaaaatga

KEGG   Rattus norvegicus (rat): 25049
Entry
25049             CDS       T01003                                 

Gene name
Atxn1
Definition
(RefSeq) ataxin-1
  KO
K23616  ataxin 1/1L
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    25049 (Atxn1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    25049 (Atxn1)
   05022 Pathways of neurodegeneration - multiple diseases
    25049 (Atxn1)
SSDB
Motif
Pfam: ATXN-1_C AXH
Other DBs
NCBI-GeneID: 25049
NCBI-ProteinID: NP_036858
RGD: 3624
Ensembl: ENSRNOG00000016998
UniProt: Q63540
Position
17
AA seq 789 aa
MKSNQERSNECLPPKKREIPATSRPSEEKATALPSDNHCVEGVAWLPSTPGSRGHGGGRH
GPAGTSGEHGLQGMGLHKALSAGLDYSPPSAPRSVPTANTLPTVYPPPQSGTPVSPVQYA
HLSHTFQFIGSSQYSGPYAGFIPSQLISPPGNPVTSAVASAAGATTPSQRSQLEAYSTLL
ANMGSLSQAPGHKVEPPPQQHLGRAAGLVNPGSPPPTQQNQYIHISSSPQSSGRATSPPI
PVHLHPHQTMIPHTLTLGPSSQVVVQYSDAGGHFVPRESTKKAESSRLQQAMQAKEVLNG
EMEKSRRYGASSSVELSLGKTSSKSVPHPYESRHVVVHPSPADYSSRDTSGVRGSVMVLP
NSSTPSADLETQQATHREASPSTLNDKSGLHLGKPGHRSYALSPHTVIQTTHSASEPLPV
GLPATAFYAGAQPPVIGYLSSQQQAITYAGGLPQHLVIPGTQPLLIPVGSPDMDTPGAAS
AIVTSSPQFAAVPHTFVTTALPKSENFNPEALVTQAAYPAMVQAQIHLPVVQSVASPAAA
SPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGV
AVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLT
LKNLKNGSVKKGQPVDPASALLKHAKTDSLAGSRHRYAEQENGINQGSAQVLSENGELKF
PEKIGLPAAPFLTKIEPSKPTATRKRRWSAPETRKLEKSEDEPPLTLPKPSLIPQEVKIC
IEGRSNVGK
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgaaatctaaccaagagcggagcaatgaatgcctgcctcccaagaaacgtgagatcccc
gccaccagtcggccctccgaggagaaggccactgctctgcccagcgacaaccactgcgtg
gagggtgtggcatggctccccagcacccctggcagccgcggccacgggggtgggcggcac
gggccagcagggacttccggggaacatggtttacaaggaatgggtttacataaagcactg
tccgcagggctggattactccccacccagtgcccccaggtcggtccccacagccaacacg
ctgcccaccgtgtaccctcctcctcagtcagggacgccggtgtctcctgtgcagtacgcc
cacctatcacataccttccagttcattgggtcctcccagtatagtgggccttacgcgggc
tttatcccttcccagctgatctccccaccaggcaacccagtcaccagtgcggtggcctcg
gctgcaggggccaccactccatcacagcgctcccagctggaggcatattccaccctgctg
gccaacatgggcagtctgagccaggcaccaggacacaaggttgagccccctccgcagcag
cacctcggcagggctgcgggattagtcaacccggggtcccctccacctacccagcagaac
cagtacattcacatttccagctctccacagagctccgggcgggcaacatctccacccatc
ccggtccacctccatccccatcagacgatgatcccgcacacgctcaccctggggccttca
tcccaggtggtcgtgcaatacagtgacgccggaggccactttgttcctcgagagtccacc
aaaaaagcagaaagcagcaggttgcagcaggctatgcaggccaaggaggtcctcaatggg
gagatggagaaaagccggaggtatggggcgtcatcttctgtggagctgagcctggggaag
acgagcagcaagtcagtgcctcacccctatgagtccaggcatgtggtggtccacccgagc
ccagcagactacagcagtcgtgatacctccggggtccgtggatctgtgatggtcctgccc
aacagcagcacaccctcagccgacctggagacacagcaggccacacatcgagaggcctcc
ccatccaccctcaatgacaagagcggtttgcacctagggaagcccggccacaggtcctac
gcgctgtccccacacacggtcattcagaccacacacagcgcatcagagcctctcccggtg
ggcctaccagccacggccttctatgctggcgctcaacctcctgtcatcggctatctgagt
agccagcagcaagcaatcacctatgctggtggtctgccccagcacctggtgatcccaggt
acccagcccctgctcatcccagtgggcagccctgacatggacacacctggggcagcctcg
gccatagtgacgtcatcgccccagtttgctgcagtacctcacacgtttgtcaccaccgcc
ctgcccaagagcgagaacttcaacccagaggctctggtcacccaggcagcctacccagcc
atggtgcaggcccagatccacctgccggtggtacagtccgtggcatcccctgccgcggca
tcacccacgctgccgccatatttcatgaaaggctccatcatccagctggccaacggggag
ctgaagaaggtagaggatctgaagacagaggatttcatccagagtgcagagattagcaat
gacctcaagatcgactccagtactgtggagaggatcgaggacagccacagccccggtgtg
gccgtgatacaatttgctgttggtgaacaccgagcccaggtcagtgtcgaagttttggta
gagtatcctttttttgtatttggacagggctggtcatcctgctgtcccgagcggaccagc
cagctctttgatctgccgtgttccaaactctccgttggggacgtctgcatctcgctcacc
ctcaagaacctgaagaatggctctgttaaaaagggccagcccgtggaccctgccagtgcc
ctgctgaagcacgcaaagaccgacagcctggctggcagcagacacagatacgccgagcag
gaaaacggaatcaaccaggggagcgcccaggtgctctctgagaacggcgaactgaagttt
ccagaaaaaattggattgcctgcagcacccttcctcaccaaaatagaaccgagcaagccc
acagccacgaggaagaggaggtggtcggcgccggagacccgtaaactggagaagtcggag
gacgagccacctttgactcttcccaagccttcgctcattcctcaggaggttaagatctgc
atcgaaggccgatctaacgtgggcaagtag

DBGET integrated database retrieval system