KEGG   Rattus norvegicus (rat): 108350839
Entry
108350839         CDS       T01003                                 

Definition
(RefSeq) high mobility group protein B1-like
  KO
K10802  high mobility group protein B1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03410  Base excision repair
rno04140  Autophagy - animal
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108350839
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108350839
  09143 Cell growth and death
   04217 Necroptosis
    108350839
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108350839
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    108350839
   03400 DNA repair and recombination proteins [BR:rno03400]
    108350839
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    108350839
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    108350839
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     108350839
   MMR (mismatch excision repair)
    Other MMR factors
     108350839
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   108350839
SSDB
Motif
Pfam: HMG_box_2 HMG_box HMG_box_5
Other DBs
NCBI-GeneID: 108350839
NCBI-ProteinID: XP_017448593
RGD: 11440908
Ensembl: ENSRNOG00000038437
UniProt: D3ZIU9
Position
4
AA seq 214 aa
MGKGYPKKPRGKMSSHAFFVQTCREEHKKKHLNASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNALKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWTNTAVDDKQPCEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEDDEEDEDEEEEEEENEDEEEEEDDDE
NT seq 645 nt   +upstreamnt  +downstreamnt
atgggcaaaggatatcctaagaagccgagaggcaaaatgtcctcacatgcattctttgtg
caaacctgccgggaggagcacaagaaaaagcacctgaatgcttctgtcaacttctcagag
ttctccaagaagtgctctgagagatggaagaccatgtctgctaaagaaaaggggaaattt
gaagatatggcaaaggctgacaaggctcgttatgaaagagaaatgaaaacctacattccc
cccaaaggggagaccaaaaagaagttcaaggaccccaatgccctcaagaggcctccatca
gccttcttcttgttctgttctgagtaccgcccaaaaatcaaaggcgagcatcctggctta
tccattggtgatgttgcgaagaaactaggagagatgtggaccaacactgccgtggatgac
aagcagccctgtgagaagaaggccgccaagctgaaggagaagtatgagaaggatattgct
gcctacagagctaaaggaaaacctgatgcagcgaaaaagggggtggtcaaggctgagaag
agcaagaaaaagaaggaagaggaagacgatgaggaggatgaagatgaggaggaagaggag
gaagaaaacgaagacgaagaagaagaagaagatgatgatgaataa

KEGG   Rattus norvegicus (rat): 25459
Entry
25459             CDS       T01003                                 

Gene name
Hmgb1
Definition
(RefSeq) high mobility group protein B1
  KO
K10802  high mobility group protein B1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03410  Base excision repair
rno04140  Autophagy - animal
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    25459 (Hmgb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    25459 (Hmgb1)
  09143 Cell growth and death
   04217 Necroptosis
    25459 (Hmgb1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    25459 (Hmgb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    25459 (Hmgb1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    25459 (Hmgb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25459 (Hmgb1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    25459 (Hmgb1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     25459 (Hmgb1)
   MMR (mismatch excision repair)
    Other MMR factors
     25459 (Hmgb1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   25459 (Hmgb1)
SSDB
Motif
Pfam: HMG_box_2 HMG_box NOA36 HMG_box_5 Nop14
Other DBs
NCBI-GeneID: 25459
NCBI-ProteinID: NP_037095
RGD: 2802
UniProt: P63159 B4F758
Structure
PDB: 
4QR9 1CKT 1AAB 1HMF 1HME

Position
12
AA seq 215 aa
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
NT seq 648 nt   +upstreamnt  +downstreamnt
atgggcaaaggagatcctaagaagccgagaggcaaaatgtcctcatatgcattctttgtg
caaacctgccgggaggagcacaagaagaagcacccggatgcttctgtcaacttctcagag
ttctccaagaagtgctcagagaggtggaagaccatgtctgctaaagaaaaggggaaattt
gaagatatggcaaaggctgacaaggctcgttatgaaagagaaatgaaaacctacatcccc
cccaaaggggagaccaaaaagaagttcaaggaccccaatgcccccaagaggcctccttcg
gccttcttcttgttctgttctgagtaccgcccaaaaatcaaaggcgagcatcctggctta
tccattggtgatgttgcgaagaaactaggagagatgtggaacaacactgctgcggatgac
aagcagccctatgaaaagaaggccgccaagctgaaggagaagtatgagaaggatattgct
gcctacagagctaaaggaaaacctgatgcagcgaaaaagggggtggtcaaggctgagaag
agcaagaaaaagaaggaagaggaagacgacgaggaggatgaagaggatgaggaagaggag
gaagaggaggaagacgaagatgaagaagaagatgatgatgatgaataa

KEGG   Rattus norvegicus (rat): 679571
Entry
679571            CDS       T01003                                 

Gene name
Hmg1l1
Definition
(RefSeq) high mobility group box 1 like
  KO
K10802  high mobility group protein B1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03410  Base excision repair
rno04140  Autophagy - animal
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    679571 (Hmg1l1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    679571 (Hmg1l1)
  09143 Cell growth and death
   04217 Necroptosis
    679571 (Hmg1l1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    679571 (Hmg1l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    679571 (Hmg1l1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    679571 (Hmg1l1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    679571 (Hmg1l1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    679571 (Hmg1l1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     679571 (Hmg1l1)
   MMR (mismatch excision repair)
    Other MMR factors
     679571 (Hmg1l1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   679571 (Hmg1l1)
SSDB
Motif
Pfam: HMG_box HMG_box_2 HMG_box_5 NOA36 Nop14
Other DBs
NCBI-GeneID: 679571
NCBI-ProteinID: NP_001102843
RGD: 1587112
Ensembl: ENSRNOG00000051482
UniProt: A0A0G2K6P4
Structure
PDB: 
4QR9 1CKT 1AAB

Position
19
AA seq 214 aa
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIPAYRAKGKPDAAKKGVVKAEK
SKKKKEEEDNEEDEEDEEEEEEEEDEDEEDDDDE
NT seq 645 nt   +upstreamnt  +downstreamnt
atgggcaaaggagatcctaagaagccgagaggcaaaatgtcctcatatgcattctttgtg
caaacctgccgggaggagcacaagaagaagcacccggatgcttctgtcaacttctcagag
ttctccaagaagtgctcagagaggtggaagaccatgtctgctaaagaaaaggggaaattt
gaagatatggcaaaggctgacaaggctcgttatgaaagagaaatgaaaacctacatcccc
cccaaaggggagaccaaaaagaagttcaaggaccccaatgcccccaagaggcctccttca
gccttcttcttgttctgttctgagtaccgcccaaaaatcaaaggcgagcatcctggctta
tccattggtgatgttgcgaagaaactaggagagatgtggaacaacactgctgcggatgac
aagcagccctatgaaaagaaggccgccaagctgaaggagaagtatgagaaggatattcct
gcctacagagctaaaggaaaacctgatgcagcgaaaaagggggtggtcaaggctgagaag
agcaagaaaaagaaggaagaggaagacaacgaggaggatgaagaggatgaggaagaggag
gaagaagaggaagacgaagatgaagaagatgatgatgatgaataa

DBGET integrated database retrieval system