KEGG   Rattus norvegicus (rat): 114110
Entry
114110            CDS       T01003                                 

Gene name
Flt4
Definition
(RefSeq) vascular endothelial growth factor receptor 3 precursor
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114110 (Flt4)
   04014 Ras signaling pathway
    114110 (Flt4)
   04015 Rap1 signaling pathway
    114110 (Flt4)
   04020 Calcium signaling pathway
    114110 (Flt4)
   04151 PI3K-Akt signaling pathway
    114110 (Flt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114110 (Flt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114110 (Flt4)
  09162 Cancer: specific types
   05224 Breast cancer
    114110 (Flt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    114110 (Flt4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     114110 (Flt4)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   114110 (Flt4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C1-set TCAD9 Haspin_kinase
Other DBs
NCBI-GeneID: 114110
NCBI-ProteinID: NP_446104
RGD: 621737
Ensembl: ENSRNOG00000002511
UniProt: Q91ZT1
Position
10
AA seq 1363 aa
MQPGAALNLRLWLCLGLLQGLANGYSMTPPTLNITEDSYVIDTGDSLSISCRGQHPLEWT
WPGAQEVLTTGGKDSEDTQVVQDCEGTEARPYCKVLSLAQTHANNTGSYYCYYKYIKARI
EGTTAASTYVFVRDFEQPFINKPDTLLVNRKDSMWVPCLVSIPGLNITLRSQSSVLHPDG
QEVLWDDRRGMRVPTLLLRDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLYPKKSL
ELLVGEKLVLNCTVWAEFDSGVTFDWDYPGKQAERAKWVPERRSQQTHTELSSILTIHNV
SQHDLGPYVCEANNGIQRFRESTEVIVHEKPFISVEWLKGPVLEATAGDEMVKLPVKLAA
YPPPEFQWYKDRKAVTGRHNPHALVLKEVTEASAGVYTLALWNSAAGLRQNISLELVVNV
PPHIHEKEASSPSIYSRHSRQTLTCTTYGVPQPLSVQWHWRPWTPCKTFAQRSLRRRQPR
DGMPQCRDWKEVTTQDAVNPIESLDTWTESVEGKNKTVSKLVIQDANVSAMYKCVVFNKV
GQDERLIYFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLSTLHD
AQGNPLLLDCKNVHLFATPLEANLEEAEPGARHATLSLNIPRVAPEDEGDYVCEVQDRRN
QDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEK
ESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILI
GTGVIAVFFWVLLLLIFCNMKRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDVSQWEF
PRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRVKRETFDPYAEKSPEQRRRF
RAMVEGAKADRRRLGSTDRALFTRFLMGKGSARRAPFVQEAEDLWLSPLTMEDLVCYSFQ
VALGMEFLASRKCIHRDLAARNILLSESDIVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKDGTRMRAPELA
TPAIRHIMQSCWSGDPKARPAFSDLVEILGDLLQGGGWQEEEEECMALHSSQSSEEDGFM
QASTTALHITEADAESSPPSMHCHSLAARYYNCVSFPGRLVRGTKAPGSSRMKTFEELPM
TPTTYKASVDNQTDSGMVLASEEFEQIESRHRQEGSFSRKDPGQHMDISRGHPDLQGRRR
RPTQGAQGGKVFYNNEYGEVSQPCTEGDCCPSAGSTFFADSNY
NT seq 4092 nt   +upstreamnt  +downstreamnt
atgcagccgggcgctgcgctgaacctgcgcctgtggctctgcctcggactcctccaaggc
ctggcaaatggctactccatgacccctccaactctgaacatcacagaggattcatatgtc
attgacaccggggacagcctatccatatcctgcagggggcagcaccccctcgagtggacc
tggccaggggcccaagaggtactgaccacaggtgggaaggacagcgaggacacgcaggtt
gtgcaagactgtgaaggcacagaagctaggccctactgcaaggtgctgtcgctggcccag
actcacgccaacaacacaggcagctattactgctactacaagtatatcaaggcccggatt
gagggcaccacagctgccagcacctatgtgtttgtaagagactttgaacagcctttcatc
aacaaacctgacacgctcctggtcaacaggaaggactcgatgtgggtgccctgcttggtg
tccattcccgggctcaacatcacactgcgctcgcaaagttcggtgctgcaccctgatggg
caggaggtgttgtgggacgaccgccggggcatgcgggtgcccactctactgttgcgtgac
gccctgtacctgcagtgcgagaccacctggggagaccaggacttcctttccaatcccttc
ctcgtgcacatcacaggcaatgagctctatgacatccagctgtaccccaagaagtcactg
gagctgttggttggagagaagctggttttgaactgtacagtatgggctgagttcgactct
ggtgtcaccttcgactgggattacccaggaaagcaggcagagcgtgctaagtgggtacct
gagcggcgttcccagcagacccacacggaactctccagcatcctgaccatccacaatgtc
agccagcacgacctgggcccctatgtgtgtgaggccaacaatgggattcagcggttccgg
gaaagcacggaggtcattgtgcacgaaaagcccttcatcagtgtcgagtggctcaaagga
cctgtcctggaggccacagccggtgacgagatggtgaagctgcccgtgaagcttgcagct
tatcccccaccggagttccaatggtacaaggacagaaaggcagtgactgggcgccacaat
ccacatgctctggtgctcaaagaggtgaccgaggccagtgcaggcgtctacaccctcgcc
ctgtggaactctgcagccggtctgaggcagaatatcagtctggagctggtggtgaatgtg
ccgccccacatccatgaaaaggaagcttcttcacccagcatctactcccgccacagccgc
cagaccctcacctgcaccacctatggggtaccccaacctctcagtgttcagtggcactgg
aggccctggacaccctgtaagacatttgcccagcgcagtctccggaggcggcagccgcgg
gatggcatgccacagtgccgagactggaaggaggtgaccactcaggacgctgtgaacccc
atcgagagcctggacacctggaccgagtctgtggagggcaagaacaagacggtgagcaag
ctggtgattcaggatgccaatgtgtcagccatgtacaaatgcgtggtcttcaacaaagtg
ggccaggacgagcggctcatctacttctatgtgaccaccatccctgacggcttcagtatc
gaatcagagccatccgaggatcccttagaaggccagtccgtgcgcctcagctgccgggcg
gacaactacacgtatgagcatctgcgctggtaccggctcaacctctccacgctgcacgac
gctcaagggaacccactactgctcgactgcaagaacgtgcacctgtttgccacgccccta
gaggccaacctagaggaggcggagcctggggcccgccacgccaccctcagcttgaatatc
ccccgagtggcgcccgaggacgagggtgactacgtgtgtgaggtgcaagataggcgcaac
caagacaagcactgccacaagaaatacctgtccgtacaggccctggaagctcctcggctc
acgcagaacttgaccgacctcctggtgaacgtgagtgactccctggagatgcgatgtccg
gtagccggagcacatgtgcccagtattgtgtggtacaaagatgaaaggctcctggagaaa
gagtcgggaatcgacctggcagactccaatcagaggctgagcatccaacgcgtgcgcgag
gaggacgcgggtcgttacctgtgcagtgtgtgcaatgccaagggctgcgtaaactcctcc
gccagcgtggccgtagaaggctcggaagataaaggcagcatggagattgtgatactcatt
ggcactggcgtcatcgcagtcttcttctgggtcctcctcctgctcatcttctgtaacatg
aaaaggcctgcccatgcagacatcaagacgggctacctgtccatcatcatggaccccggg
gaggtgcctttggaggagcagtgtgaatacctgtcctatgacgtcagccagtgggagttc
cccagggaaaggttgcacctcgggagagtcctaggccatggggcttttgggaaggtggtg
gaagcctcagcctttggcatcaataaaggcagcagctgtgataccgtggcggtgaagatg
ctgaaagagggcgctactgccagcgaacaccgtgccctgatgtccgagctcaagatccta
attcacatcggtaaccacctcaatgtggtcaacctcctaggggcgtgcaccaagcccaat
ggccctctcatggtgatcgtggagttttgcaaatacggcaacctctccaacttcttgcgt
gtcaagcgggagacgttcgacccctacgcagagaagtctcccgagcaacgcaggcgcttc
cgcgcgatggtagaaggcgccaaggctgataggaggagacttggaagcaccgacagagcc
ctgtttacaaggttcctgatgggcaaaggaagtgcacggcgagccccatttgtccaagaa
gctgaggacctgtggttgagcccgctgaccatggaggaccttgtctgctacagtttccaa
gtggccctgggaatggagttcctggcttcccgcaagtgcattcacagagacctggctgct
cggaacattttactgtcagaaagtgacatagtgaagatctgtgactttggcctcgctcgg
gacatctacaaagaccctgactatgtccgaaagggcagcgcccgactgcctctgaaatgg
atggcccccgagagcatcttcgataaggtgtacaccacgcagagtgatgtgtggtccttc
ggagtgctgctgtgggagattttctcactgggggcctctccataccctggggtacagatc
aatgaggaattctgccagcggctgaaagacggcacacgaatgagggccccagaactggcc
actcctgccatacgccacatcatgcagagttgctggtctggagaccctaaagcgaggcct
gctttctctgacctagtggagatcctgggggacctgcttcagggtggaggctggcaggag
gaggaggaggaatgcatggccctgcacagttctcagagctcagaggaggatggcttcatg
caggcatccaccacagctctacatatcacggaggctgacgctgagagcagtccacccagc
atgcattgccacagcctggcagccagatattacaactgtgtgtcctttcctgggcgcctg
gtcagggggactaaggctccaggttcctccaggatgaagacgtttgaagaattgcccatg
acccctacaacctacaaagcctctgtggataaccaaacagacagcgggatggtgctggcc
tcagaagagtttgagcagatagaaagcaggcatagacaagaaggcagcttcagccgtaaa
gatcctggccagcacatggatatttccagaggacacccggacctccaggggaggcggcga
cggcccacccagggggcacaaggaggcaaggtgttttacaacaacgagtatggggaggtc
tcccagccgtgtacagaaggtgactgctgcccgtctgctggctccaccttcttcgcagac
agcaactactaa

DBGET integrated database retrieval system