KEGG   Rattus norvegicus (rat): 114111
Entry
114111            CDS       T01003                                 

Gene name
Vegfc
Definition
(RefSeq) vascular endothelial growth factor C precursor
  KO
K05449  vascular endothelial growth factor C/D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04668  TNF signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114111 (Vegfc)
   04014 Ras signaling pathway
    114111 (Vegfc)
   04015 Rap1 signaling pathway
    114111 (Vegfc)
   04668 TNF signaling pathway
    114111 (Vegfc)
   04020 Calcium signaling pathway
    114111 (Vegfc)
   04151 PI3K-Akt signaling pathway
    114111 (Vegfc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114111 (Vegfc)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    114111 (Vegfc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114111 (Vegfc)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    114111 (Vegfc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    114111 (Vegfc)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   114111 (Vegfc)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 114111
NCBI-ProteinID: NP_446105
RGD: 619800
Ensembl: ENSRNOG00000011416
UniProt: O35757
Position
16
AA seq 415 aa
MHLLCFLSLACSLLAAALIPGPREAPATVAAFESGLGFSEAEPDGGEVKGFEGKDLEEQL
RSVSSVDELMSVLYPDYWKMYKCQLRKGGWQQPSLNMRTGDTVKLAAAHYNTEILKSIDN
EWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKT
LFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCP
ANYVWNNYMCQCLAQQDFIFYSNVEDDSSNGFHDVCGPNKELDEDTCQCVCKGGLRPSSC
GPHKELDRDSCQCVCKNKLFLNSCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTE
NTQKCFLKGKKFHHQTCSCYRRPCTNRLKHCDPGLSFSEEVCRCVPSYWKRPHLN
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcacttgctgtgcttcttgtctctggcgtgttccttgctcgccgctgcgctgatcccc
ggtccgcgcgaggcgcccgccaccgtcgccgccttcgagtcgggactgggcttctcggaa
gcagagccggacgggggcgaggtcaagggtttcgaaggcaaagacctggaggagcagttg
cggtctgtgtccagtgtagatgagctcatgtctgtcctgtacccagactactggaaaatg
tacaagtgccagctaaggaaaggcggctggcagcagccctccctcaacatgaggacaggg
gacactgtaaaacttgctgctgcacattacaacactgagatcctgaaaagtattgataat
gagtggagaaagactcaatgcatgccacgtgaggtgtgtatagatgtggggaaggagttt
ggagcagccacaaacaccttctttaaacctccatgtgtgtccgtctacagatgtgggggt
tgctgcaacagtgaagggctgcaatgcatgaacaccagcacaggttacctcagcaagacg
ttgtttgaaattacagtgcctctctctcaaggccccaaaccagtcacaatcagttttgcc
aatcacacttcctgccggtgcatgtctaaactggatgtttacagacaagttcattcaatt
attagacgttctctgccagcaacattaccacagtgtcaggcagctaacaagacttgtcca
gcaaactacgtgtggaataactacatgtgtcaatgcctggctcagcaggattttatcttt
tattcaaatgttgaggatgactcatccaatggattccatgatgtctgtggacccaacaag
gagttggatgaagacacctgccagtgtgtctgcaagggggggcttcgaccatccagctgt
ggaccccacaaagagctagatagagactcatgccagtgtgtctgtaaaaacaaacttttc
cttaattcatgtggagccaacagggaatttgatgagaacacatgccagtgtgtctgcaag
agaacatgtccaagaaatcaacccctgaatcctggaaaatgtgcctgtgaatgtacagaa
aacacacagaagtgcttcctaaaagggaagaaattccaccatcaaacatgcagctgttac
agacgaccatgtacaaatcgactgaagcattgtgatccgggactgtcatttagtgaagag
gtgtgtcgctgtgtcccatcatattggaaaagaccacatctgaactaa

KEGG   Rattus norvegicus (rat): 116499
Entry
116499            CDS       T01003                                 

Gene name
Fgf4
Definition
(RefSeq) fibroblast growth factor 4 precursor
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116499 (Fgf4)
   04014 Ras signaling pathway
    116499 (Fgf4)
   04015 Rap1 signaling pathway
    116499 (Fgf4)
   04020 Calcium signaling pathway
    116499 (Fgf4)
   04151 PI3K-Akt signaling pathway
    116499 (Fgf4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116499 (Fgf4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116499 (Fgf4)
   05207 Chemical carcinogenesis - receptor activation
    116499 (Fgf4)
  09162 Cancer: specific types
   05226 Gastric cancer
    116499 (Fgf4)
   05218 Melanoma
    116499 (Fgf4)
   05224 Breast cancer
    116499 (Fgf4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    116499 (Fgf4)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    116499 (Fgf4)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   116499 (Fgf4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   116499 (Fgf4)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 116499
NCBI-ProteinID: NP_001376141
RGD: 620127
Ensembl: ENSRNOG00000020890
Position
1
AA seq 202 aa
MAKRGPTTGTLLPGVLLALVVALADRGTAAPNGTRHAELGHGWDGLVARSLARLPVAAQP
PQAAVRSGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRG
VVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKN
GRTKKGNRVSPTMKVTHFLPRL
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcgaagcgcgggccgactacagggacgctgctgcccggggtcctgctggccctggtg
gtggccctggcggaccgagggaccgccgcacccaacggcacgcggcacgccgaattgggg
cacggctgggacggcctggtggcccgctcgctggcacgcttgccggtggccgcgcagccc
ccgcaggcggcggtccgcagcggcgcaggggactacctgctgggcctcaaaaggctgcgg
agactctactgcaacgtgggcatcggattccacctgcaggtgctgcccgacggccgcatc
ggcggtgtgcacgcggacacgagggacagccttctggagctctctccggtgcagcggggt
gtggtgagcatcttcggagtggccagccggttcttcgtggccatgagcagcaggggcaag
ctcttcggtgtgcctttctttaccgacgagtgtaaattcaaagaaatacttctccccaac
aactacaatgcctacgagtcctacgcatacccgggcatgttcatggccctcagtaagaac
gggcggaccaagaaggggaaccgagtttcgccgaccatgaaggtaacccacttccttcct
agactgtga

KEGG   Rattus norvegicus (rat): 116683
Entry
116683            CDS       T01003                                 

Gene name
Efna5
Definition
(RefSeq) ephrin-A5 precursor
  KO
K05462  ephrin-A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116683 (Efna5)
   04014 Ras signaling pathway
    116683 (Efna5)
   04015 Rap1 signaling pathway
    116683 (Efna5)
   04151 PI3K-Akt signaling pathway
    116683 (Efna5)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    116683 (Efna5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    116683 (Efna5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    116683 (Efna5)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    116683 (Efna5)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   116683 (Efna5)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   116683 (Efna5)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 116683
NCBI-ProteinID: NP_446355
RGD: 620391
UniProt: P97605
Position
9
AA seq 228 aa
MLHVEMLTLLFLVLWMCVFSQDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVRDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgttgcacgtggagatgttgacgctgctctttctggtgctctggatgtgtgtgttcagc
caggacccgggctccaaagtcgtcgccgaccgctacgccgtctactggaacagcagcaac
cccagattccagaggggtgactaccacatcgatgtctgtatcaatgactacctggatgtt
ttctgccctcactatgaggactctgtaccagaggataagactgagcgctatgtcctgtac
atggtgaattttgatggctacagtgcctgcgaccacacatccaaagggttcaagagatgg
gaatgtaaccggcctcactctccaaacggaccgctgaagttctcggagaaattccagctc
ttcactcccttttctttaggatttgaattcaggccaggccgagagtatttctacatctcc
tctgcaatcccagacaatggaagaagatcctgcctaaagctcaaagtctttgtgaggcca
acaaacagctgtatgaaaactataggtgttcgtgatcgtgttttcgatgttaacgacaaa
gtagaaaattcattagaaccagcagatgacaccgtacatgagtcagccgagccatcccgc
ggagagaacgcggcacaaacaccaaggatacccagccgccttttggcaatcctactgttc
ctcctggcgatgcttttgacattatag

KEGG   Rattus norvegicus (rat): 170579
Entry
170579            CDS       T01003                                 

Gene name
Fgf22
Definition
(RefSeq) fibroblast growth factor 22 precursor
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    170579 (Fgf22)
   04014 Ras signaling pathway
    170579 (Fgf22)
   04015 Rap1 signaling pathway
    170579 (Fgf22)
   04020 Calcium signaling pathway
    170579 (Fgf22)
   04151 PI3K-Akt signaling pathway
    170579 (Fgf22)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    170579 (Fgf22)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170579 (Fgf22)
   05207 Chemical carcinogenesis - receptor activation
    170579 (Fgf22)
  09162 Cancer: specific types
   05226 Gastric cancer
    170579 (Fgf22)
   05218 Melanoma
    170579 (Fgf22)
   05224 Breast cancer
    170579 (Fgf22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    170579 (Fgf22)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    170579 (Fgf22)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   170579 (Fgf22)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   170579 (Fgf22)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 170579
NCBI-ProteinID: NP_570107
RGD: 620177
Ensembl: ENSRNOG00000008960
UniProt: Q8VI79
Position
7
AA seq 162 aa
MRRRLWLGLAWLLLARAPGAPGGYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHG
QDSIVEIRSVRVGTVVIKAVYSGFYVAMNRRGRLYGSRVYSVDCRFRERIEENGYNTYAS
RRWRHHGRPMFLALDSQGIPRQGRRTRRHQLSTHFLPVLVSS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcgccgccgcctctggctgggcctggcctggctgctgctggcgcgggcaccgggagcc
ccgggcgggtacccacatctggagggcgacgtgcgctggcgccgcctcttctcctccacc
cactttttcctgcgtgtggatcctggtggtcgggtgcaggggacgcgttggcgacacggg
caggacagtattgttgagatccgttctgtccgtgtgggcactgtggtgatcaaagctgtg
tactcaggcttctatgtggccatgaatcgcaggggccgcctctatgggtcgcgggtctac
tctgtggactgtaggttccgggagcgcatcgaggagaacggctacaacacatacgcctca
cgacgttggaggcaccacggccgacccatgttcttggcactggacagccagggcattccc
aggcaaggcagacggacgcgtcggcaccaactgtccacacacttcctaccagtactggtc
tcatcttga

KEGG   Rattus norvegicus (rat): 170580
Entry
170580            CDS       T01003                                 

Gene name
Fgf21
Definition
(RefSeq) fibroblast growth factor 21 precursor
  KO
K22429  fibroblast growth factor 21
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04714  Thermogenesis
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    170580 (Fgf21)
   04014 Ras signaling pathway
    170580 (Fgf21)
   04015 Rap1 signaling pathway
    170580 (Fgf21)
   04020 Calcium signaling pathway
    170580 (Fgf21)
   04151 PI3K-Akt signaling pathway
    170580 (Fgf21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    170580 (Fgf21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    170580 (Fgf21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170580 (Fgf21)
  09162 Cancer: specific types
   05226 Gastric cancer
    170580 (Fgf21)
   05218 Melanoma
    170580 (Fgf21)
   05224 Breast cancer
    170580 (Fgf21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    170580 (Fgf21)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    170580 (Fgf21)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   170580 (Fgf21)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   170580 (Fgf21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 170580
NCBI-ProteinID: NP_570108
RGD: 620175
Ensembl: ENSRNOG00000020990
UniProt: Q8VI80
Position
1
AA seq 208 aa
MDWMKSRVGAPGLWVCLLLPVFLLGVCEAYPISDSSPLLQFGGQVRQRYLYTDDDQDTEA
HLEIREDGTVVGTAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGTLYGSPHFDPE
ACSFRELLLKDGYNVYQSEAHGLPLRLPQKDSQDPATRGPVRFLPMPGLPHEPQEQPGVL
PPEPPDVGSSDPLSMVEPLQGRSPSYAS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggactggatgaaatctagagttggggccccgggactgtgggtctgtctcctgctgcct
gtcttcctgctgggggtgtgcgaggcataccccatctctgactccagccccctcctccag
tttgggggtcaagtccgacagaggtatctctacacagatgacgaccaggacaccgaagcc
cacctggagatcagggaggacggaacagtggtgggcacagcacaccgcagtccagaaagt
ctcctggagctcaaagccttgaagccaggggtcattcaaatcctgggtgtcaaagcctct
aggtttctttgccaacaaccagatggaactctctatggatcgcctcactttgatcctgag
gcctgcagtttcagagagctgctgcttaaggacggatacaatgtgtaccagtctgaggcc
catggcctgcccctgcgtctgccccagaaggactcccaggatccagcaacccggggacct
gtgcgcttcctgcccatgccaggcctgccccacgagccccaagagcaaccaggagtcctt
cccccagagcccccagatgtgggttcctccgaccccctgagcatggtagagcctttgcaa
ggccgaagccccagctatgcatcttga

KEGG   Rattus norvegicus (rat): 170582
Entry
170582            CDS       T01003                                 

Gene name
Fgf19
Definition
(RefSeq) fibroblast growth factor 19 precursor
  KO
K22603  fibroblast growth factor 19
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    170582 (Fgf19)
   04014 Ras signaling pathway
    170582 (Fgf19)
   04015 Rap1 signaling pathway
    170582 (Fgf19)
   04020 Calcium signaling pathway
    170582 (Fgf19)
   04151 PI3K-Akt signaling pathway
    170582 (Fgf19)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    170582 (Fgf19)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170582 (Fgf19)
  09162 Cancer: specific types
   05226 Gastric cancer
    170582 (Fgf19)
   05218 Melanoma
    170582 (Fgf19)
   05224 Breast cancer
    170582 (Fgf19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    170582 (Fgf19)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    170582 (Fgf19)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   170582 (Fgf19)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   170582 (Fgf19)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 170582
NCBI-ProteinID: NP_570109
RGD: 620166
Ensembl: ENSRNOG00000020899
UniProt: Q8VI81
Position
1
AA seq 218 aa
MARKWSGRIVARALVLATLWLAVSGRPLVQQSQSVSDEGPLFLYGWGKITRLQYLYSAGP
YVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLI
RYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIKAKPREQLQGQKPSNFIPIFHRSFFES
TDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcgagaaagtggagtgggcgtattgtggcccgagctctggtcctggccactctgtgg
ctggccgtgtctgggcgtcccctggtccagcaatcccagtctgtgtcggatgaaggtcca
ctctttctctatggctggggcaagattacccgcctgcagtacctgtactctgctggtccc
tacgtctccaactgcttcctgcgtatccggagtgacggctctgtggactgcgaggaggac
cagaacgaacgaaatctgttggagttccgcgcggttgctctgaagacaattgccatcaag
gacgtcagcagcgtgcggtacctctgcatgagcgccgacggcaagatatacgggctgatt
cgctactcggaggaagactgtaccttcagggaggaaatggactgtttgggctacaaccag
tacaggtccatgaagcaccacctccacatcatcttcatcaaggccaagcccagagagcag
ctccagggccagaaaccttcaaactttatccccatatttcaccggtctttctttgaatcc
acggaccagctgaggtctaaaatgttctctctgcccctggagagcgacagcatggatccg
ttcagaatggtggaggatgtggaccacctagtgaagagtcccagcttccagaaatga

KEGG   Rattus norvegicus (rat): 170583
Entry
170583            CDS       T01003                                 

Gene name
Fgf23
Definition
(RefSeq) fibroblast growth factor 23 precursor
  KO
K22428  fibroblast growth factor 23
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04928  Parathyroid hormone synthesis, secretion and action
rno05200  Pathways in cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    170583 (Fgf23)
   04014 Ras signaling pathway
    170583 (Fgf23)
   04015 Rap1 signaling pathway
    170583 (Fgf23)
   04020 Calcium signaling pathway
    170583 (Fgf23)
   04151 PI3K-Akt signaling pathway
    170583 (Fgf23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    170583 (Fgf23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    170583 (Fgf23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170583 (Fgf23)
  09162 Cancer: specific types
   05226 Gastric cancer
    170583 (Fgf23)
   05218 Melanoma
    170583 (Fgf23)
   05224 Breast cancer
    170583 (Fgf23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    170583 (Fgf23)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    170583 (Fgf23)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   170583 (Fgf23)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   170583 (Fgf23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 170583
NCBI-ProteinID: NP_570110
RGD: 620178
Ensembl: ENSRNOG00000052205
UniProt: Q8VI82
Position
4
AA seq 251 aa
MLGACLRLLVGALCTVCSLGTARAYSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGH
VDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTL
ENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRS
AEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGG
TDRCRPFPRFV
NT seq 756 nt   +upstreamnt  +downstreamnt
atgctgggggcctgcctcagactcctggtgggcgctctgtgcaccgtctgcagcttgggc
actgctagagcctattcagacacttccccactgcttggctccaactgggggagcctgacc
cacctgtacacagctacagccaggaacagctatcacctacagatccatagggatggccat
gtagacggaacaccccatcagactatctacagtgccctgatgatcacatcagaggatgct
ggctccgtagtgataataggggccatgaccagaaggttcctttgtatggatctccgcggc
aacatttttggatcgtatcacttcagcccggagaactgcagattccgccagtggacgcta
gagaacggctacgacgtctacctgtcaccgaagcatcactacctggtgagcttgggccgc
tccaagcgcatcttccagcccggtaccaacccgccgcccttctcgcagttcctggcgcgc
aggaacgaggtcccgctgctgcacttctacaccgcgcgcccacggcgccacacgcgcagc
gccgaggacccgcccgagcgcgacccgctgaatgtgctcaagccgcggccccgcgctact
cccataccggtatcctgctcgcgagagctaccgagtgcagaggaaggtggccccgcggcc
agcgaccccctgggagtgctgcgcagaggccgcggggatgctcgccggggcgcgggaggc
acggatcggtgtcgcccctttcccaggttcgtctag

KEGG   Rattus norvegicus (rat): 170633
Entry
170633            CDS       T01003                                 

Gene name
Fgf3
Definition
(RefSeq) fibroblast growth factor 3 precursor
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    170633 (Fgf3)
   04014 Ras signaling pathway
    170633 (Fgf3)
   04015 Rap1 signaling pathway
    170633 (Fgf3)
   04020 Calcium signaling pathway
    170633 (Fgf3)
   04151 PI3K-Akt signaling pathway
    170633 (Fgf3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    170633 (Fgf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170633 (Fgf3)
   05207 Chemical carcinogenesis - receptor activation
    170633 (Fgf3)
  09162 Cancer: specific types
   05226 Gastric cancer
    170633 (Fgf3)
   05218 Melanoma
    170633 (Fgf3)
   05224 Breast cancer
    170633 (Fgf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    170633 (Fgf3)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    170633 (Fgf3)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   170633 (Fgf3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   170633 (Fgf3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 170633
NCBI-ProteinID: NP_570830
RGD: 620126
Ensembl: ENSRNOG00000020888
UniProt: Q8R5L9
Position
1
AA seq 245 aa
MGLIWLLLLSLLEPGWPATGPGTRLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGVVAIKGLFSGRYLAMNKRGRLYASEHYNAECEFVER
IHELGYNTYASRLYRTGPSGPGARRQPGAQRPWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLGHKDHEMVRLLQSGQPQAPGEGSQPRQRRQKKQSPGDHGKMEHLPTKATTSAQLDTG
GLAMA
NT seq 738 nt   +upstreamnt  +downstreamnt
atgggcctgatctggcttctgctgctcagcttgctggaacccggctggccagctacgggg
cccgggacgcgacttcgacgcgatgcgggcggccgtggcggcgtttacgagcacctcggc
ggggcgccccggcgccgcaagctctactgcgctaccaagtaccacctccagcttcacccg
agcggccgcgtgaacggcagccttgagaacagcgcctatagcatcctggagattactgct
gtggaggtgggcgtggtggccatcaaagggctcttttctgggcggtacctggccatgaac
aagagaggacggctgtatgcttcggagcactacaacgcagagtgtgagtttgtggaacgg
atccacgagctgggttacaatacatatgcttcccgcctataccgcacggggcccagtggg
ccaggggctcgacggcagcctggtgcccagagaccttggtacgtgtctgtgaacggcaag
ggtcggccacgcaggggcttcaagacccgccgcacacagaagtcttctctcttcctgccc
cgagtgctgggtcacaaggaccatgagatggtacggctgctgcagagtggccagccacaa
gccccaggagagggcagccaacccaggcagcggaggcagaagaagcagagcccaggtgat
catggcaaaatggagcatttgccaaccaaggccactacaagcgcccaactggatacaggg
ggactggctatggcttga

KEGG   Rattus norvegicus (rat): 170700
Entry
170700            CDS       T01003                                 

Gene name
Fgf6
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    170700 (Fgf6)
   04014 Ras signaling pathway
    170700 (Fgf6)
   04015 Rap1 signaling pathway
    170700 (Fgf6)
   04020 Calcium signaling pathway
    170700 (Fgf6)
   04151 PI3K-Akt signaling pathway
    170700 (Fgf6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    170700 (Fgf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170700 (Fgf6)
   05207 Chemical carcinogenesis - receptor activation
    170700 (Fgf6)
  09162 Cancer: specific types
   05226 Gastric cancer
    170700 (Fgf6)
   05218 Melanoma
    170700 (Fgf6)
   05224 Breast cancer
    170700 (Fgf6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    170700 (Fgf6)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    170700 (Fgf6)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   170700 (Fgf6)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   170700 (Fgf6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 170700
NCBI-ProteinID: NP_571983
RGD: 620130
Ensembl: ENSRNOG00000053662
UniProt: Q8R5L5
Position
4
AA seq 208 aa
MALGQRLFITMSRGAGRVQGTLQALVFLGVLVGMVVPSPAGARANGTLLDSRGWGTLLSR
SRAGLAGEISGVNWESGYLVGIKRQRRLYCNVGIGFHLQVPPDGRISGTHEENPYSLLEI
STVERGVVSLFGVKSALFIAMNSKGRLYTTPSFQDECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtcccggggagcaggacgtgttcagggc
acgctgcaggctctcgtcttcttaggcgtcctagtgggcatggtggtgccctcacctgcc
ggcgcccgcgccaacggcacgctactggactccagaggctggggcaccctcttgtccagg
tctcgagctgggctagctggagagatttcgggtgtgaattgggaaagtggctatttggtg
ggcattaagcgacagcggagactctactgcaacgtgggcattggcttccacctccaggtg
cctcccgacggccggatcagtgggacgcacgaggagaacccctacagcctgctggaaatc
tccacggtagaacggggtgtggtgagcctctttggtgtgaaaagtgctctcttcattgcc
atgaacagtaaaggaagactgtacacaacgcccagcttccaggacgaatgcaagttcaga
gaaaccctccttccaaacaactacaacgcctacgagtccgacctgtacagagggacctac
attgcactgagcaaatatggacgggtaaagcggggcagcaaggtgtccccaatcatgact
gtcactcacttcctccccaggatataa

KEGG   Rattus norvegicus (rat): 170901
Entry
170901            CDS       T01003                                 

Gene name
Efna3
Definition
(RefSeq) ephrin-A3 isoform X1
  KO
K05462  ephrin-A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    170901 (Efna3)
   04014 Ras signaling pathway
    170901 (Efna3)
   04015 Rap1 signaling pathway
    170901 (Efna3)
   04151 PI3K-Akt signaling pathway
    170901 (Efna3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    170901 (Efna3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    170901 (Efna3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    170901 (Efna3)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    170901 (Efna3)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   170901 (Efna3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   170901 (Efna3)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 170901
NCBI-ProteinID: XP_574979
RGD: 620390
Ensembl: ENSRNOG00000057322
Position
2
AA seq 230 aa
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQR
YSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGP
NVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTLLAS
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcggcggctccgctgctgctgctgctgctgctcgtgcccgtgccgctgctgccgctg
ctggcccaggggcctgggggcgcgctgggaaaccggcatgcggtatactggaacagctcc
aaccagcacctgcggcgcgagggctacacggtgcaagtgaacgtgaacgactatctggat
atttactgtcctcactacaacagctcagggcctggcggcggggcggagcagtacgtacta
tacatggtgaacctgagcggctaccgcacctgcaacgccagccaaggctccaagcgctgg
gaatgcaaccggcagcacgcctcgcacagccccatcaagttctccgagaagttccagcgc
tacagcgccttctcgctgggctatgaattccatgccggccaagaatactactatatctcc
acgcccactcacaacctgcattggaagtgtctgaggatgaaggtgttcgtctgctgcgcc
tccacatcgcactccggggagaagccggtccccactctcccccagttcaccatgggcccc
aatgtgaagatcaacgtgttggaagactttgagggagagaatccccaggtgcccaagctt
gagaagagcatcagtggaaccagccccaagcgggaacacctgcctctggccgtgggcatc
gccttcttcctcatgacgctcttggcctcctag

KEGG   Rattus norvegicus (rat): 24446
Entry
24446             CDS       T01003                                 

Gene name
Hgf
Definition
(RefSeq) hepatocyte growth factor preproprotein
  KO
K05460  hepatocyte growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno05144  Malaria
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05211  Renal cell carcinoma
rno05218  Melanoma
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24446 (Hgf)
   04014 Ras signaling pathway
    24446 (Hgf)
   04015 Rap1 signaling pathway
    24446 (Hgf)
   04020 Calcium signaling pathway
    24446 (Hgf)
   04151 PI3K-Akt signaling pathway
    24446 (Hgf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24446 (Hgf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24446 (Hgf)
   05205 Proteoglycans in cancer
    24446 (Hgf)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24446 (Hgf)
   05226 Gastric cancer
    24446 (Hgf)
   05218 Melanoma
    24446 (Hgf)
   05211 Renal cell carcinoma
    24446 (Hgf)
   05223 Non-small cell lung cancer
    24446 (Hgf)
  09174 Infectious disease: parasitic
   05144 Malaria
    24446 (Hgf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24446 (Hgf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24446 (Hgf)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24446 (Hgf)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   24446 (Hgf)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   24446 (Hgf)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316
Other DBs
NCBI-GeneID: 24446
NCBI-ProteinID: NP_058713
RGD: 2794
Ensembl: ENSRNOG00000007027
UniProt: P17945
Position
4
AA seq 728 aa
MMWGTKLLPVLLLQHVLLHLLLLPVTIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLVKI
KTKKVNSADECANRCIRNKGFPFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLY
ENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRN
PRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQT
PHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSAVNETDVP
METTECIKGQGEGYRGTTNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLTKNYCRNPDDDAHGPWCYTGNPLVPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPAR
NKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTI
DLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL
CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KVILTYKL
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgatgtgggggaccaaacttctgccggtcctgttgctgcagcatgtcctgctgcacctc
ctcctgcttcctgtcaccatcccctatgcagaaggacagaagaagagaagaaatactctt
catgaattcaaaaagtcagcaaaaactactcttaccaaggaagacccattagtgaagatt
aaaaccaaaaaagtgaactctgcagatgagtgtgccaacaggtgcatcagaaacaagggc
tttccattcacttgcaaggcctttgtttttgataagtcgagaaaacgatgctactggtat
cctttcaatagtatgtcaagtggagtgaaaaaagggtttggccatgaatttgacctctat
gaaaacaaagactatattagaaattgcatcattggtaaaggaggcagctataaggggaca
gtatccatcactaagagtggcatcaagtgccagccttggaattccatgatcccccatgaa
cacagctttttgccttcgagctatcgcggtaaagacctacaggaaaactactgtcgaaat
cctcgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaa
gtctgtgacattcctcagtgttcagaagttgaatgcatgacctgcaacggtgaaagctac
agaggtcccatggatcacacagaatcaggcaagacatgtcagcgctgggatcagcagaca
ccacaccggcacaaattcttgccggaaagatatcccgacaagggctttgatgataattat
tgccgcaatcccgatggcaagccgaggccatggtgctacactcttgaccctgacacccct
tgggagtattgtgcaattaaaatgtgcgctcacagtgctgtgaatgagactgatgttccc
atggaaacaactgaatgtataaaaggccaaggagaaggttacaggggaaccaccaatacc
atttggaatggaattccgtgtcagcgttgggattcgcagtacccccacaagcatgacatc
actcccgagaacttcaaatgcaaggaccttagagaaaattattgccgcaatccggatggg
gctgaatcaccatggtgttttaccactgatccaaacatccgagttggttactgctctcaa
attcccaaatgtgacgtgtcaagtggacaagattgttatcgtggcaatgggaaaaactac
atgggcaacttatccaaaacaaggtctggactcacatgttccatgtgggacaagaatatg
gaggatttacaccgtcatatcttctgggagccagacgctagcaagttgactaagaattac
tgccggaaccccgatgacgacgcccatggaccttggtgctacacagggaatcctctcgtt
ccttgggattattgccctatttcccgttgtgaaggagatactacacctacaattgtcaat
ttggaccatcctgtaatatcctgtgccaaaacaaaacaactgcgagttgtaaatggcatt
ccaacacaaacaacagtagggtggatggttagtttgaaatacaggaataaacacatctgt
gggggatcattgataaaggaaagttgggttcttactgcaaggcaatgttttccagctaga
aacaaagacttgaaagactatgaagcttggcttggaatccatgatgtccatgagagaggc
gaggagaaacgcaaacagatcttaaacatttcccagctagtctatggacctgaaggctca
gatttggttttactgaagcttgctcgccctgcaatcctggataactttgtcagtacaatt
gatttacctagttatggctgtacaatccctgaaaagactacttgcagtatttacggctgg
ggctacactggattgatcaacgcagatggtttattacgagtagctcatctgtatattatg
gggaatgagaaatgcagtcagcaccatcaaggcaaggtgactttgaatgagtctgaatta
tgtgctggggctgaaaagattggatcaggaccttgtgagggagattatggtggcccactc
atttgtgaacaacacaaaatgagaatggttcttggtgtcattgttcctggtcgtggatgt
gccatcccaaatcgtcctggtatttttgttcgagtagcatattatgcaaaatggatacac
aaagtaattttgacatacaagttgtaa

KEGG   Rattus norvegicus (rat): 24482
Entry
24482             CDS       T01003                                 

Gene name
Igf1
Definition
(RefSeq) insulin-like growth factor I isoform d preproprotein
  KO
K05459  insulin-like growth factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04114  Oocyte meiosis
rno04115  p53 signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04510  Focal adhesion
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05410  Hypertrophic cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24482 (Igf1)
   04014 Ras signaling pathway
    24482 (Igf1)
   04015 Rap1 signaling pathway
    24482 (Igf1)
   04066 HIF-1 signaling pathway
    24482 (Igf1)
   04068 FoxO signaling pathway
    24482 (Igf1)
   04151 PI3K-Akt signaling pathway
    24482 (Igf1)
   04152 AMPK signaling pathway
    24482 (Igf1)
   04150 mTOR signaling pathway
    24482 (Igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    24482 (Igf1)
   04115 p53 signaling pathway
    24482 (Igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24482 (Igf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    24482 (Igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    24482 (Igf1)
   04914 Progesterone-mediated oocyte maturation
    24482 (Igf1)
   04935 Growth hormone synthesis, secretion and action
    24482 (Igf1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24482 (Igf1)
  09156 Nervous system
   04730 Long-term depression
    24482 (Igf1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24482 (Igf1)
  09149 Aging
   04211 Longevity regulating pathway
    24482 (Igf1)
   04213 Longevity regulating pathway - multiple species
    24482 (Igf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24482 (Igf1)
   05202 Transcriptional misregulation in cancer
    24482 (Igf1)
   05205 Proteoglycans in cancer
    24482 (Igf1)
  09162 Cancer: specific types
   05214 Glioma
    24482 (Igf1)
   05218 Melanoma
    24482 (Igf1)
   05215 Prostate cancer
    24482 (Igf1)
   05224 Breast cancer
    24482 (Igf1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    24482 (Igf1)
   05414 Dilated cardiomyopathy
    24482 (Igf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24482 (Igf1)
   01522 Endocrine resistance
    24482 (Igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24482 (Igf1)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   24482 (Igf1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 24482
NCBI-ProteinID: NP_001075948
RGD: 2868
Ensembl: ENSRNOG00000004517
UniProt: P08025 Q5RK13
Position
7
AA seq 153 aa
MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSARS
IRAQRHTDMPKTQKEVHLKNTSRGSAGNKTYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggggaaaatcagcagtcttccaactcaattatttaagatctgcctctgtgacttcttg
aagataaagatacacatcatgtcgtcttcacatctcttctacctggcactctgcttgctc
acctttaccagctcggccacagccggaccagagaccctttgcggggctgagctggtggac
gctcttcagttcgtgtgtggaccaaggggcttttacttcaacaagcccacaggctatggc
tccagcattcggagggcaccacagacgggcattgtggatgagtgttgcttccggagctgt
gatctgaggaggctggagatgtactgtgctccgctgaagcctacaaagtcagctcgttcc
atccgggcccagcgccacactgacatgcccaagactcagaaggaagtacacttgaagaac
acaagtagaggaagtgcaggaaacaagacctacagaatgtag

KEGG   Rattus norvegicus (rat): 24505
Entry
24505             CDS       T01003                                 

Gene name
Ins1
Definition
(RefSeq) insulin-1 preproprotein
  KO
K04526  insulin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04911  Insulin secretion
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04940  Type I diabetes mellitus
rno04950  Maturity onset diabetes of the young
rno04960  Aldosterone-regulated sodium reabsorption
rno05010  Alzheimer disease
rno05215  Prostate cancer
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24505 (Ins1)
   04014 Ras signaling pathway
    24505 (Ins1)
   04015 Rap1 signaling pathway
    24505 (Ins1)
   04066 HIF-1 signaling pathway
    24505 (Ins1)
   04068 FoxO signaling pathway
    24505 (Ins1)
   04072 Phospholipase D signaling pathway
    24505 (Ins1)
   04022 cGMP-PKG signaling pathway
    24505 (Ins1)
   04151 PI3K-Akt signaling pathway
    24505 (Ins1)
   04152 AMPK signaling pathway
    24505 (Ins1)
   04150 mTOR signaling pathway
    24505 (Ins1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24505 (Ins1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    24505 (Ins1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24505 (Ins1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24505 (Ins1)
   04910 Insulin signaling pathway
    24505 (Ins1)
   04923 Regulation of lipolysis in adipocytes
    24505 (Ins1)
   04913 Ovarian steroidogenesis
    24505 (Ins1)
   04914 Progesterone-mediated oocyte maturation
    24505 (Ins1)
   04917 Prolactin signaling pathway
    24505 (Ins1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24505 (Ins1)
  09149 Aging
   04211 Longevity regulating pathway
    24505 (Ins1)
   04213 Longevity regulating pathway - multiple species
    24505 (Ins1)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    24505 (Ins1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24505 (Ins1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    24505 (Ins1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    24505 (Ins1)
   04940 Type I diabetes mellitus
    24505 (Ins1)
   04950 Maturity onset diabetes of the young
    24505 (Ins1)
   04932 Non-alcoholic fatty liver disease
    24505 (Ins1)
   04931 Insulin resistance
    24505 (Ins1)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 24505
NCBI-ProteinID: NP_062002
RGD: 2915
Ensembl: ENSRNOG00000012052
UniProt: P01322
Position
1
AA seq 110 aa
MALWMRFLPLLALLVLWEPKPAQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVED
PQVPQLELGGGPEAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
NT seq 333 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcgcttcctgcccctgctggccctgctcgtcctctgggagcccaag
cctgcccaggcttttgtcaaacagcacctttgtggtcctcacctggtggaggctctgtac
ctggtgtgtggggaacgtggtttcttctacacacccaagtcccgtcgtgaagtggaggac
ccgcaagtgccacaactggagctgggtggaggcccggaggccggggatcttcagaccttg
gcactggaggttgcccggcagaagcgtggcattgtggatcagtgctgcaccagcatctgc
tccctctaccaactggagaactactgcaactga

KEGG   Rattus norvegicus (rat): 24506
Entry
24506             CDS       T01003                                 

Gene name
Ins2
Definition
(RefSeq) insulin-2 preproprotein
  KO
K04526  insulin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04911  Insulin secretion
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04940  Type I diabetes mellitus
rno04950  Maturity onset diabetes of the young
rno04960  Aldosterone-regulated sodium reabsorption
rno05010  Alzheimer disease
rno05215  Prostate cancer
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24506 (Ins2)
   04014 Ras signaling pathway
    24506 (Ins2)
   04015 Rap1 signaling pathway
    24506 (Ins2)
   04066 HIF-1 signaling pathway
    24506 (Ins2)
   04068 FoxO signaling pathway
    24506 (Ins2)
   04072 Phospholipase D signaling pathway
    24506 (Ins2)
   04022 cGMP-PKG signaling pathway
    24506 (Ins2)
   04151 PI3K-Akt signaling pathway
    24506 (Ins2)
   04152 AMPK signaling pathway
    24506 (Ins2)
   04150 mTOR signaling pathway
    24506 (Ins2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24506 (Ins2)
  09143 Cell growth and death
   04114 Oocyte meiosis
    24506 (Ins2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24506 (Ins2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24506 (Ins2)
   04910 Insulin signaling pathway
    24506 (Ins2)
   04923 Regulation of lipolysis in adipocytes
    24506 (Ins2)
   04913 Ovarian steroidogenesis
    24506 (Ins2)
   04914 Progesterone-mediated oocyte maturation
    24506 (Ins2)
   04917 Prolactin signaling pathway
    24506 (Ins2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24506 (Ins2)
  09149 Aging
   04211 Longevity regulating pathway
    24506 (Ins2)
   04213 Longevity regulating pathway - multiple species
    24506 (Ins2)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    24506 (Ins2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24506 (Ins2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    24506 (Ins2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    24506 (Ins2)
   04940 Type I diabetes mellitus
    24506 (Ins2)
   04950 Maturity onset diabetes of the young
    24506 (Ins2)
   04932 Non-alcoholic fatty liver disease
    24506 (Ins2)
   04931 Insulin resistance
    24506 (Ins2)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 24506
NCBI-ProteinID: NP_062003
RGD: 2916
Ensembl: ENSRNOG00000020405
UniProt: P01323
Position
1
AA seq 110 aa
MALWIRFLPLLALLILWEPRPAQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVED
PQVAQLELGGGPGAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
NT seq 333 nt   +upstreamnt  +downstreamnt
atggccctgtggatccgcttcctgcccctgctggccctgctcatcctctgggagccccgc
cctgcccaggcttttgtcaaacagcacctttgtggttctcacttggtggaagctctctac
ctggtgtgtggggagcgtggattcttctacacacccatgtcccgccgcgaagtggaggac
ccacaagtggcacaactggagctgggtggaggcccgggggcaggtgaccttcagaccttg
gcactggaggtggcccggcagaagcgcggcatcgtggatcagtgctgcaccagcatctgc
tctctctaccaactggagaactactgcaactag

KEGG   Rattus norvegicus (rat): 24628
Entry
24628             CDS       T01003                                 

Gene name
Pdgfb
Definition
(RefSeq) platelet-derived growth factor subunit B precursor
  KO
K17386  platelet-derived growth factor subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04630  JAK-STAT signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05211  Renal cell carcinoma
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05231  Choline metabolism in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24628 (Pdgfb)
   04014 Ras signaling pathway
    24628 (Pdgfb)
   04015 Rap1 signaling pathway
    24628 (Pdgfb)
   04630 JAK-STAT signaling pathway
    24628 (Pdgfb)
   04020 Calcium signaling pathway
    24628 (Pdgfb)
   04072 Phospholipase D signaling pathway
    24628 (Pdgfb)
   04151 PI3K-Akt signaling pathway
    24628 (Pdgfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24628 (Pdgfb)
   04540 Gap junction
    24628 (Pdgfb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24628 (Pdgfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24628 (Pdgfb)
   05206 MicroRNAs in cancer
    24628 (Pdgfb)
   05231 Choline metabolism in cancer
    24628 (Pdgfb)
  09162 Cancer: specific types
   05214 Glioma
    24628 (Pdgfb)
   05218 Melanoma
    24628 (Pdgfb)
   05211 Renal cell carcinoma
    24628 (Pdgfb)
   05215 Prostate cancer
    24628 (Pdgfb)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    24628 (Pdgfb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24628 (Pdgfb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24628 (Pdgfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24628 (Pdgfb)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24628 (Pdgfb)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   24628 (Pdgfb)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   24628 (Pdgfb)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 24628
NCBI-ProteinID: NP_113712
RGD: 3283
Ensembl: ENSRNOG00000017197
UniProt: Q05028 G3V882
Position
7
AA seq 241 aa
MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAEL
DLNMTRAHSGVESESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKC
ETVVTPRPVTRSPGTSREHRAKTPQTRVTVRTVRIRRPPKGKHRKFKHTHDKKALKEILG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgcctctctgctgctacctgcgtctggtcagcgct
gagggggatcccattcctgaggaactctatgaaatgctgagtgaccactccatccgctcc
tttgatgaccttcagcgcctgctgcacagagactccgtagacgaagatggggctgagctg
gacttgaacatgacccgagcacattctggagtcgagtcggaaagctcatctcgagggagg
aggagcctagggtctctggctgcagcagagcctgccgtaatcgccgagtgcaagacgcgt
acagaggtgttccagatctcgcggaacctcatcgatcgcaccaatgccaacttcctggtg
tggccgccctgcgtggaggtgcagcgctgctcgggctgctgcaataaccgcaatgtgcag
tgccgggcctcgcaggtgcagatgcggccggtgcaggtgagaaagatcgaaattgtgaga
aagaagccagtcttcaagaaggccacagtgaccctggaggaccatctggcctgcaagtgt
gagacagtagtgacccctcggcccgtgactcgaagtcctgggacatccagggagcatcga
gccaagacacctcaaactcgggtgaccgttcggacggtgcgaatccgccggccccccaaa
gggaagcaccgaaagtttaagcacacccatgacaagaaggcactgaaggagatccttgga
gcctag

KEGG   Rattus norvegicus (rat): 25266
Entry
25266             CDS       T01003                                 

Gene name
Pdgfa
Definition
(RefSeq) platelet-derived growth factor subunit A precursor
  KO
K04359  platelet-derived growth factor subunit A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04630  JAK-STAT signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05231  Choline metabolism in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25266 (Pdgfa)
   04014 Ras signaling pathway
    25266 (Pdgfa)
   04015 Rap1 signaling pathway
    25266 (Pdgfa)
   04630 JAK-STAT signaling pathway
    25266 (Pdgfa)
   04020 Calcium signaling pathway
    25266 (Pdgfa)
   04072 Phospholipase D signaling pathway
    25266 (Pdgfa)
   04151 PI3K-Akt signaling pathway
    25266 (Pdgfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25266 (Pdgfa)
   04540 Gap junction
    25266 (Pdgfa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25266 (Pdgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25266 (Pdgfa)
   05202 Transcriptional misregulation in cancer
    25266 (Pdgfa)
   05206 MicroRNAs in cancer
    25266 (Pdgfa)
   05231 Choline metabolism in cancer
    25266 (Pdgfa)
  09162 Cancer: specific types
   05214 Glioma
    25266 (Pdgfa)
   05218 Melanoma
    25266 (Pdgfa)
   05215 Prostate cancer
    25266 (Pdgfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25266 (Pdgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25266 (Pdgfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25266 (Pdgfa)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25266 (Pdgfa)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   25266 (Pdgfa)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   25266 (Pdgfa)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 25266
NCBI-ProteinID: NP_036933
RGD: 3282
Ensembl: ENSRNOG00000001312
UniProt: P28576
Position
12
AA seq 196 aa
MRTWACLLLLGCGYLAHALAEEAEIPRELIERLARSQIHSIRDLQRLLEIDSVGAEDALE
TNLRAHGSHTVKHVPEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACA
TSNLNPDHREEETDVR
NT seq 591 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctgctcctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagataccccgggagttgatcgagcgactggctcgaagtcagatccacagc
atccgggacctccagcgactcttggagatagactccgtaggggctgaggatgccttggag
acaaacctgagagcccatgggtcccacactgttaagcatgtgccggagaagcggcctgtg
cccatccgcaggaagagaagtattgaggaagccattcccgcagtttgcaagaccaggacg
gtcatttacgagatacctcggagccaggtggaccccacatcggccaacttcttgatctgg
cccccatgtgtggaggtgaagcgctgcactggctgctgtaacaccagcagcgtcaagtgc
cagccctcaagggtccaccaccgcagtgtcaaggtggccaaagtggagtatgtcaggaag
aagccaaaattgaaagaggtccaggtgaggttagaggagcacctggagtgcgcatgcgcg
acctccaacctgaacccagaccatcgggaggaggagacggatgtgaggtga

KEGG   Rattus norvegicus (rat): 25313
Entry
25313             CDS       T01003                                 

Gene name
Egf
Definition
(RefSeq) pro-epidermal growth factor precursor
  KO
K04357  epidermal growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04630  JAK-STAT signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05226  Gastric cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25313 (Egf)
   04012 ErbB signaling pathway
    25313 (Egf)
   04014 Ras signaling pathway
    25313 (Egf)
   04015 Rap1 signaling pathway
    25313 (Egf)
   04630 JAK-STAT signaling pathway
    25313 (Egf)
   04066 HIF-1 signaling pathway
    25313 (Egf)
   04068 FoxO signaling pathway
    25313 (Egf)
   04020 Calcium signaling pathway
    25313 (Egf)
   04072 Phospholipase D signaling pathway
    25313 (Egf)
   04151 PI3K-Akt signaling pathway
    25313 (Egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25313 (Egf)
   04540 Gap junction
    25313 (Egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25313 (Egf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25313 (Egf)
   05207 Chemical carcinogenesis - receptor activation
    25313 (Egf)
   05231 Choline metabolism in cancer
    25313 (Egf)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25313 (Egf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    25313 (Egf)
   05212 Pancreatic cancer
    25313 (Egf)
   05226 Gastric cancer
    25313 (Egf)
   05214 Glioma
    25313 (Egf)
   05218 Melanoma
    25313 (Egf)
   05219 Bladder cancer
    25313 (Egf)
   05215 Prostate cancer
    25313 (Egf)
   05213 Endometrial cancer
    25313 (Egf)
   05224 Breast cancer
    25313 (Egf)
   05223 Non-small cell lung cancer
    25313 (Egf)
  09172 Infectious disease: viral
   05160 Hepatitis C
    25313 (Egf)
   05165 Human papillomavirus infection
    25313 (Egf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25313 (Egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25313 (Egf)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   25313 (Egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF_CA cEGF EGF EGF_3 DUF5050 Tr-sialidase_C hEGF LtrA
Other DBs
NCBI-GeneID: 25313
NCBI-ProteinID: NP_036974
RGD: 2542
Ensembl: ENSRNOG00000053979
UniProt: P07522
Position
2
AA seq 1133 aa
MLFSLTFLSVFLKITVLSVTAQQTRNCQSGPLERSGTTTYAAAGPPRFLIFLQGNSIFRI
NTDGTNHQQLVVDAGVSVVMDFHYKEERLYWVDLERQLLQRVFFNGSGQETVCKVDKNVS
GLAINWIDGEILRTDRWKGVITVTDMNGNNSRVLLSSLKRPANILVDPTERLIFWSSVVT
GNLHRADLGGMDVKTLLEAPERISVLILDILDKRLFWAQDGREGSHGYIHSCDYNGGSIH
HIRHQARHDLLTMAIFGDKILYSALKEKAIWIADKHTGKNVVRVNLDPASVPPRELRVVH
LHAQPGTENRAQASDSERCKQRRGQCLYSLSERDPNSDSSACAEGYTLSRDRKYCEDVNE
CALQNHGCTLGCENIPGSYYCTCPTGFVLLPDGKRCHELVACPGNRSECSHDCILTSDGP
LCICPAGSVLGKDGKTCTGCSFSDNGGCSQICLPLSLASWECDCFPGYDLQLDRKSCAAS
MGPQPFLLFANSQDIRHMHFDGTDYKTLLSRQMGMVFALDYDPVESKIYFAQTALKWIER
ANLDGSQRERRITEGVDTPEGLAVDWIGRRIYWTDSGKSVIEGSDLSGKHHQIIIKESIS
RPRGIAVHPKARRLFWTDTGMSPRIESSSLQGSDRTLIASSNLLEPSGIAIDYLTDTLYW
CDTKLSVIEMADLDGSKRRRLTQNDVGHPFSLAVFEDHVWFSDWAIPSVIRVNKRTGQNR
VRLRGSMLKPSSLVVVHPLAKPGADPCLHRNGGCEHICQESLGTAQCLCREGFVKAPDGK
MCLTRKDDQILAGDNADLSKEVASLDNSPKAYVPDDDRTESSTLVAEIMVSGLNYEDDCG
PGGCGSHAHCISEGEAAVCQCLKGFAGDGNLCSDIDECELGSSDCPPTSSRCINTEGGYV
CQCSEGYEGDGIYCLDVDECQQGSHGCSENATCTNTEGGYNCTCAGCPSAPGLPCPDSTS
PSLLGKDGCHWVRNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDL
RWWKLRHADYGQRHDITVVSVCVVALALLLLLGMWGTYYYRTRKQLSESSKKPSEESSSN
VSSNGPDSSGAGVSSGPQPWFVVLEEHQQPKNGRLPAAGTNGAVVEAGLSSSL
NT seq 3402 nt   +upstreamnt  +downstreamnt
atgctgttctcgctcaccttcctgtcggtgtttttaaagattactgtactcagtgtcaca
gcacagcagaccaggaactgtcagtcaggtcctctcgagagaagcgggactaccacgtat
gccgccgccggtcctcccaggttcctgattttcttacaaggaaacagcatctttcggatt
aacacagatggaacaaatcaccagcaattggtggtggatgccggcgtctcagtggtcatg
gattttcattacaaggaagagagactctattgggtggatttagaaagacaacttttgcaa
agagttttctttaatgggtcaggacaagagacagtgtgcaaggtggataagaatgtgtct
gggctggccataaactggatagatggggagattctccggacggaccgatggaagggagtc
atcacagtaacagatatgaacgggaacaattcccgtgttcttctgagttccttaaaacgt
cctgcaaatatattagtggatccaacagagaggttgatattttggtcttcagtggtgact
ggcaaccttcacagagcagatctcgggggtatggatgtaaaaacactgctggaggcacca
gagaggatatcagtgctgattctggatatcctggacaaaaggctcttctgggctcaggac
ggtagagaaggaagccacggttacattcactcctgtgactataacggtggctccatccat
catatcagacatcaagcacggcacgatttgcttactatggccattttcggtgacaagatc
ttatactcagcactgaaagagaaggcgatttggatagccgacaaacacactgggaagaat
gtggttcgagttaacctcgatccagcctctgtgccgccaagagaactgagagtcgtgcac
ctacatgcacagcccgggacagagaaccgtgctcaggcctctgactccgaacgatgcaaa
cagagaagaggacagtgtctctacagtctctctgagcgagaccccaactcagactcgtcg
gcatgcgctgaaggctatacgttaagccgagaccggaagtactgcgaagatgtcaatgag
tgtgccttgcagaatcacggctgtactcttgggtgtgaaaacatccctggatcctattac
tgcacatgccctacaggctttgttctgcttcctgatgggaaacgatgtcacgaacttgtt
gcctgtccaggcaacagatcagagtgtagccatgattgcatcctgacatcagatggtcct
ctgtgcatctgtccagcaggttcagtgctcggaaaagatgggaagacatgcactggttgt
tccttctccgataatggtggatgcagccagatctgccttcctctcagcctagcatcctgg
gaatgtgattgctttcctgggtacgacctacaattggaccgaaagagctgtgcagcttcc
atgggaccgcagccatttttactgtttgcaaattcccaggacatacgacacatgcatttt
gatggaacagactacaaaactctgctcagccggcagatgggaatggtttttgccttggat
tatgaccccgtggaaagcaagatatattttgcacagacagccctgaagtggatagagagg
gctaatctggatggctcccagcgagaaagacggatcacggaaggagtagacacgccagaa
ggtcttgccgtggactggattggccggagaatctactggacggacagtgggaagtctgtc
attgaagggagtgatttgagcgggaagcatcatcaaataatcatcaaagagagcatctca
aggccacgaggaatagctgtgcatccaaaggccaggagactattctggacggacacgggg
atgtctccgcggattgaaagctcttcccttcaaggttctgaccggacgctgatagccagc
tctaatctactggaacccagtggaatcgcgattgactacttaacagacactttgtactgg
tgtgacaccaagctgtctgtgattgaaatggccgatctagatggttccaaacgccgcaga
cttacccagaacgatgtaggtcacccattctctctagctgtgtttgaggatcacgtgtgg
ttctcggattgggctatcccatcggtaataagggtgaacaagaggactggtcaaaacagg
gtacgtctccgaggcagcatgctgaagccctcgtcactggttgtggtccacccattggca
aaaccaggtgcagacccctgcttacacaggaatggaggctgtgaacacatctgccaagag
agcctgggcacggctcagtgtctgtgtcgggaaggattcgtgaaggccccagatgggaaa
atgtgtctcactcggaaggatgatcagatactggccggtgacaatgctgatcttagtaaa
gaggtggcatcgttggacaactcccctaaggcttatgtaccagacgatgataggacagag
tcctccacactagtggctgagatcatggtgtcagggctgaactatgaagatgactgcggc
cctggtgggtgtggcagccatgcccactgtatttcagagggagaggcagctgtgtgtcag
tgtttgaaaggatttgctggcgatggaaacctgtgttctgatatagacgaatgtgagctg
ggtagctcagactgtcctcccacctcgtccaggtgcatcaacaccgaaggtggctatgtc
tgccaatgctcagaaggctacgagggagatgggatctactgtctcgacgttgatgagtgc
cagcaggggtcgcacggctgcagcgagaatgccacctgcaccaacacggagggaggctac
aactgcacctgtgcaggctgcccatcagcacctggactgccttgccctgactctacctca
ccctctctccttggaaaagatggctgccactgggtccgaaacagtaacacaggatgcccg
ccgtcgtacgatgggtactgcctcaatggtggcgtgtgcatgtatgttgaatccgtggac
cgctacgtgtgcaactgtgtcattggctatattggagaacgatgtcagcaccgagactta
cgttggtggaagctgcgccatgctgactacgggcagaggcacgacatcactgtggtgtct
gtctgtgtggtggcgctggccctgctgctcctcttagggatgtgggggacttactactac
aggactcggaagcagctatcagagagctcaaagaagccttccgaagagtcaagcagcaac
gtgagcagtaacgggcctgacagcagcggggctggggtgtcttctggtccccaaccttgg
tttgtggtcctagaggaacaccaacagcccaagaatgggcgtctgcctgccgctggcacg
aacggcgcagtagtagaggctggcctgtcttcctccctgtaa

KEGG   Rattus norvegicus (rat): 25317
Entry
25317             CDS       T01003                                 

Gene name
Fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04390  Hippo signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25317 (Fgf1)
   04014 Ras signaling pathway
    25317 (Fgf1)
   04015 Rap1 signaling pathway
    25317 (Fgf1)
   04390 Hippo signaling pathway
    25317 (Fgf1)
   04020 Calcium signaling pathway
    25317 (Fgf1)
   04151 PI3K-Akt signaling pathway
    25317 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25317 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25317 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    25317 (Fgf1)
   05218 Melanoma
    25317 (Fgf1)
   05224 Breast cancer
    25317 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25317 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25317 (Fgf1)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   25317 (Fgf1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   25317 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 25317
NCBI-ProteinID: NP_036978
RGD: 2605
Ensembl: ENSRNOG00000013867
UniProt: P61149
Structure
PDB: 
2UUS 2J3P

Position
18
AA seq 155 aa
MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgaaggggagatcacaacctttgcagccctgaccgagaggttcaatctgcctcta
gggaactacaaaaaacccaaactgctctactgcagcaacgggggccacttcttgaggatt
cttcccgatggcaccgtggatgggaccagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgcgggcgaagtgtatataaagggtacagagactggccagtacttg
gccatggacaccgaagggcttttatacggctcgcagacaccaaatgaagaatgcctattc
ctggaaaggctagaagaaaaccattataacacttacacatccaagaagcacgcggagaag
aactggtttgtgggcctcaagaagaacgggagttgtaagcgcggtcctcggactcactac
ggccagaaagccatcttgtttctccccctcccggtatcttctgactaa

KEGG   Rattus norvegicus (rat): 25443
Entry
25443             CDS       T01003                                 

Gene name
Fgf10
Definition
(RefSeq) fibroblast growth factor 10 precursor
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25443 (Fgf10)
   04014 Ras signaling pathway
    25443 (Fgf10)
   04015 Rap1 signaling pathway
    25443 (Fgf10)
   04020 Calcium signaling pathway
    25443 (Fgf10)
   04151 PI3K-Akt signaling pathway
    25443 (Fgf10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25443 (Fgf10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25443 (Fgf10)
   05207 Chemical carcinogenesis - receptor activation
    25443 (Fgf10)
  09162 Cancer: specific types
   05226 Gastric cancer
    25443 (Fgf10)
   05218 Melanoma
    25443 (Fgf10)
   05224 Breast cancer
    25443 (Fgf10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25443 (Fgf10)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25443 (Fgf10)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   25443 (Fgf10)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   25443 (Fgf10)
SSDB
Motif
Pfam: FGF Fascin SR-25 IMUP
Other DBs
NCBI-GeneID: 25443
NCBI-ProteinID: NP_037083
RGD: 2606
Ensembl: ENSRNOG00000012278
UniProt: P70492
Position
2
AA seq 215 aa
MWKWILTHCASAFPHLPGCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSSSSSS
SSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEI
TSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNG
RQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgccgggctgctgt
tgctgcttcttgttgctcttcttggtgtcttccgtccctgtcacctgccaagctcttggt
caggacatggtgtcaccggaggctaccaactcctcttcctcctcctcttcctcctcctcg
tcctcttccttctcctctccttccagcgcggggaggcatgtgcgaagctacaatcacctc
cagggagatgtccgctggagaaagctgttctccttcaccaagtactttctcaagattgaa
aagaacggcaaggtcagcgggaccaagaaggaaaactgtccgtacagtatcctagagata
acatcagtggaaatcggagttgttgccgtcaaagccattaacagcaactattacttagcc
atgaacaagaaggggaaactctatggctcaaaagaatttaacaatgactgtaaactgaaa
gagaggatagaggaaaatggatacaacacctatgcatcttttaactggcagcacaacggc
aggcaaatgtatgtggcattgaatggaaaaggagctcccaggagaggacaaaaaacaaga
aggaaaaacacctccgctcacttcctccccatggtggtccactcatag

KEGG   Rattus norvegicus (rat): 25444
Entry
25444             CDS       T01003                                 

Gene name
Fgf9
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25444 (Fgf9)
   04014 Ras signaling pathway
    25444 (Fgf9)
   04015 Rap1 signaling pathway
    25444 (Fgf9)
   04020 Calcium signaling pathway
    25444 (Fgf9)
   04151 PI3K-Akt signaling pathway
    25444 (Fgf9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25444 (Fgf9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25444 (Fgf9)
   05207 Chemical carcinogenesis - receptor activation
    25444 (Fgf9)
  09162 Cancer: specific types
   05226 Gastric cancer
    25444 (Fgf9)
   05218 Melanoma
    25444 (Fgf9)
   05224 Breast cancer
    25444 (Fgf9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25444 (Fgf9)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25444 (Fgf9)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   25444 (Fgf9)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   25444 (Fgf9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 25444
NCBI-ProteinID: NP_037084
RGD: 2610
Ensembl: ENSRNOG00000011471
UniProt: P36364
Position
15
AA seq 208 aa
MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggagctatttcggtgtgcaggacgcggtaccgttcggg
aacgtaccggtgttgccggtggacagtccggtgttgctaagtgaccacctgggtcagtcc
gaagcaggggggctgccccggggacccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctgtactgcaggactggatttcacttagaaatcttccccaacggt
actatccagggaaccaggaaagaccacagccgattcggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgtggtgtggacagtggactctacctcggcatgaacgag
aagggggagctgtatggatcagaaaaactaacacaggagtgcgtgttcagagaacagttt
gaagaaaactggtacaacacctactcttccaacctgtacaagcacgtggacaccggaagg
agatactatgttgcattaaataaggatgggactccaagagaagggaccaggactaaacgg
caccagaaatttacacattttttacctagaccagtggaccctgacaaagtacctgaacta
tataaggatattctaagccaaagttga

KEGG   Rattus norvegicus (rat): 29348
Entry
29348             CDS       T01003                                 

Gene name
Fgf7
Definition
(RefSeq) fibroblast growth factor 7 precursor
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29348 (Fgf7)
   04014 Ras signaling pathway
    29348 (Fgf7)
   04015 Rap1 signaling pathway
    29348 (Fgf7)
   04020 Calcium signaling pathway
    29348 (Fgf7)
   04151 PI3K-Akt signaling pathway
    29348 (Fgf7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29348 (Fgf7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29348 (Fgf7)
   05207 Chemical carcinogenesis - receptor activation
    29348 (Fgf7)
  09162 Cancer: specific types
   05226 Gastric cancer
    29348 (Fgf7)
   05218 Melanoma
    29348 (Fgf7)
   05224 Breast cancer
    29348 (Fgf7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29348 (Fgf7)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29348 (Fgf7)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   29348 (Fgf7)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   29348 (Fgf7)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 29348
NCBI-ProteinID: NP_071518
RGD: 61805
Ensembl: ENSRNOG00000009425
UniProt: Q02195
Structure
PDB: 
1QQK

Position
3
AA seq 194 aa
MRKWILTRILPTPLYRPCFHLVCLVGTISLACNDMSPEQTATSVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMRNSYNIMEIMTVAVGIVAIKGVESEYYLA
MNKQGELYAKKECNEDCNFKELILENHYNTSASAKWTHSGGEMFVALNQKGLPVKGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcgcaaatggatactgacacggatcctgccgactccgctctacagaccgtgcttccac
ctcgtctgtcttgtgggcaccatatctttagcttgcaatgacatgagtccagagcagacg
gccacgagcgtgaactgttctagccccgagcgacacacgagaagttatgactacatggaa
ggaggggatataagggtgaggagactgttctgtcgcacccagtggtacctgaggattgac
aaacgaggcaaagtgaaagggacccaggagatgaggaacagctacaacatcatggaaatc
atgactgtggcagttggaattgtggcaatcaaaggggtggaaagtgaatactatcttgcc
atgaacaaacaaggggaactctatgcaaagaaagaatgcaatgaggattgcaacttcaaa
gaactgattctggaaaaccattacaacacctctgcatcagctaaatggacacacagcgga
ggggaaatgttcgtggccttaaatcaaaaggggcttcctgtcaaagggaagaaaacgaag
aaagaacaaaaaacggcccactttcttcctatggcaataacttaa

KEGG   Rattus norvegicus (rat): 29349
Entry
29349             CDS       T01003                                 

Gene name
Fgf8
Definition
(RefSeq) fibroblast growth factor 8 precursor
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29349 (Fgf8)
   04014 Ras signaling pathway
    29349 (Fgf8)
   04015 Rap1 signaling pathway
    29349 (Fgf8)
   04020 Calcium signaling pathway
    29349 (Fgf8)
   04151 PI3K-Akt signaling pathway
    29349 (Fgf8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29349 (Fgf8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29349 (Fgf8)
   05207 Chemical carcinogenesis - receptor activation
    29349 (Fgf8)
  09162 Cancer: specific types
   05226 Gastric cancer
    29349 (Fgf8)
   05218 Melanoma
    29349 (Fgf8)
   05224 Breast cancer
    29349 (Fgf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29349 (Fgf8)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29349 (Fgf8)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   29349 (Fgf8)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   29349 (Fgf8)
SSDB
Motif
Pfam: FGF Fascin FRG1
Other DBs
NCBI-GeneID: 29349
NCBI-ProteinID: NP_579820
RGD: 70891
Ensembl: ENSRNOG00000017524
UniProt: Q76LI5
Position
1
AA seq 204 aa
MGSPRSALSCLLLHLLVLCLQAQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANK
RINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTE
IVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRF
EFLNYPPFTRSLRGSQRTWAPEPR
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctgttgcacttgctggttctctgcctc
caagcccagcatgtgagggagcagagcctggtgacggatcagctcagccgccgcctcatc
cggacctaccagctctacagccgcaccagcgggaagcacgtgcaggtcctggccaacaag
cgcatcaacgccatggcagaagacggagaccccttcgcaaagctcattgtggagaccgat
acttttggaagcagagtccgagtccgcggagcagagaccggtctgtacatctgcatgaac
aagaaggggaagctaatcgccaagagcaacggcaaaggcaaggactgcgtgttcacggag
atcgtgctggagaacaactacacggcgctgcagaacgccaagtacgagggctggtacatg
gcctttacccgcaagggccggccccgcaagggttccaagacgcgccagcaccagcgcgag
gtgcacttcatgaagcgcctgccgcggggccaccacaccacagagcagagcctccgcttc
gagttcctcaactacccgcccttcacgcgcagcctgcgcggcagccagaggacttgggcc
ccggagccccgatag

KEGG   Rattus norvegicus (rat): 29368
Entry
29368             CDS       T01003                                 

Gene name
Fgf17
Definition
(RefSeq) fibroblast growth factor 17 precursor
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29368 (Fgf17)
   04014 Ras signaling pathway
    29368 (Fgf17)
   04015 Rap1 signaling pathway
    29368 (Fgf17)
   04020 Calcium signaling pathway
    29368 (Fgf17)
   04151 PI3K-Akt signaling pathway
    29368 (Fgf17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29368 (Fgf17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29368 (Fgf17)
   05207 Chemical carcinogenesis - receptor activation
    29368 (Fgf17)
  09162 Cancer: specific types
   05226 Gastric cancer
    29368 (Fgf17)
   05218 Melanoma
    29368 (Fgf17)
   05224 Breast cancer
    29368 (Fgf17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29368 (Fgf17)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29368 (Fgf17)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   29368 (Fgf17)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   29368 (Fgf17)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 29368
NCBI-ProteinID: NP_062071
RGD: 2607
Ensembl: ENSRNOG00000012912
UniProt: P63076
Position
15
AA seq 216 aa
MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggagccgcccgcctgctgcctaaccttaccctgtgcttgcagctattgatcctctgc
tgtcaaacgcagggggagaatcacccgtctcctaattttaaccagtacgtgagggaccag
ggcgctatgactgaccagctgagcaggcggcaaatccgtgagtaccagctctacagccgg
accagtggcaagcacgtgcaggtcaccgggcgtcgcatctctgccaccgctgaggatggc
aacaagttcgccaagctcatcgtggagacagacacattcggcagcagagtccgcatcaag
ggggcagagagcgagaagtatatctgtatgaacaagaggggcaagctgattgggaagccg
agcgggaagagcaaagactgcgtattcaccgagatcgtactggagaacaactacacagcc
ttccagaacgcccggcatgagggctggttcatggctttcacccggcagggccggcctcgc
caggcctcccggagccgccagaaccagcgagaggcccacttcatcaagcgcctctaccaa
ggccagctgcctttccccaaccacgctgaaaggcagaagcagttcgaattcgtgggctcc
gcccccactcgcaggaccaagcgcactcggaggccccagtcccaaacgtag

KEGG   Rattus norvegicus (rat): 29369
Entry
29369             CDS       T01003                                 

Gene name
Fgf18
Definition
(RefSeq) fibroblast growth factor 18 precursor
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29369 (Fgf18)
   04014 Ras signaling pathway
    29369 (Fgf18)
   04015 Rap1 signaling pathway
    29369 (Fgf18)
   04020 Calcium signaling pathway
    29369 (Fgf18)
   04151 PI3K-Akt signaling pathway
    29369 (Fgf18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29369 (Fgf18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29369 (Fgf18)
   05207 Chemical carcinogenesis - receptor activation
    29369 (Fgf18)
  09162 Cancer: specific types
   05226 Gastric cancer
    29369 (Fgf18)
   05218 Melanoma
    29369 (Fgf18)
   05224 Breast cancer
    29369 (Fgf18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29369 (Fgf18)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29369 (Fgf18)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   29369 (Fgf18)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   29369 (Fgf18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 29369
NCBI-ProteinID: NP_062072
RGD: 2608
UniProt: O88182
Position
10
AA seq 207 aa
MYSAPSACTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQTELQKPFKYTTVTKRSRRIRPTHPG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacactttctactgctgtgcttc
caggttcaggtgttggcagccgaggagaacgtggacttccgcatccatgtggagaaccag
actcgggctcgcgatgatgtgagtcggaagcagctgcgcttgtaccagctctacagcagg
accagtgggaagcacattcaagtcctgggccgtaggatcagtgcccgtggcgaggacggg
gacaagtatgcccagctcctagtggagacggataccttcgggagtcaagtccggatcaag
ggcaaagagacagagttctacctgtgtatgaaccgaaaaggcaagctcgtggggaagcct
gatggtactagcaaggagtgcgtgttcattgagaaggttctggaaaacaactacacggcc
ctgatgtcagccaagtactcaggctggtacgtgggcttcaccaagaaggggcggcctcgc
aagggtcccaagacccgcgaaaaccagcaagatgtgcacttcatgaagcgttaccccaag
ggacagactgagctgcagaagcccttcaagtacaccacagttactaagcgatcccggcgg
atccgccccactcaccccggctag

KEGG   Rattus norvegicus (rat): 296269
Entry
296269            CDS       T01003                                 

Gene name
Angpt4
Definition
(RefSeq) angiopoietin-4 precursor
  KO
K05467  angiopoietin 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    296269 (Angpt4)
   04014 Ras signaling pathway
    296269 (Angpt4)
   04015 Rap1 signaling pathway
    296269 (Angpt4)
   04066 HIF-1 signaling pathway
    296269 (Angpt4)
   04151 PI3K-Akt signaling pathway
    296269 (Angpt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    296269 (Angpt4)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   296269 (Angpt4)
SSDB
Motif
Pfam: Fibrinogen_C ANAPC15
Other DBs
NCBI-GeneID: 296269
NCBI-ProteinID: NP_001099996
RGD: 1307539
Ensembl: ENSRNOG00000005008
UniProt: D3ZR43
Position
3
AA seq 508 aa
MLRPPAMLLDGLLLLATMAAAQHRGPEASGRRQIHRVQHGQCSYTFVLPEPDICQLAPVA
PEGLGGSNSLQRDLPAARHHLTDWRAQRAQRAQRVSQLEKILENNTQWLLKLEQSIQMNL
RSDLAQAQQHTIQNQTTTMLALGANLMNQTMAQTHKLTAVEAQVLNHTSRVKTQMLESSL
STNKLERQMLMQSRELQRLQGRNRALETRLQALEAQHQAQLNSLQDKREQLQSLLGHQTG
ALANLKHSLRALSSNSSSLQQQQQQLMELVQRLVRIVAQDQHPVSLKTPKPLFRDCAEIK
RSGANTSGVYTIHGANMTKPLKVFCDMETDGGGWTLIQRREDGSLNFQRTWEEYKEGFGN
VAREHWLGNEAVHSLTSRTAYLLRVELHDWEGHQTSIQYENFQLGSERQRYSLSVNDSSI
SARLKNSLAPQGTKFSTKDMDNDNCMCKCAQMLSGGWWFDACGLSNLNGIYYPVHQHLHK
INGIRWHYFRGPSYSLHGTRMMLRPMGA
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgctccgcccgccagctatgctactagatggcctcctcctgctggccaccatggctgca
gcccagcacagagggccagaagccagtgggcgccgccagattcaccgggtccagcacggc
cagtgtagctacacctttgtgctgcctgagccagatatctgccagctggcgccggtggca
cctgagggtttggggggctccaatagcctccagagggacttgcctgccgcaaggcaccac
ctaacagactggcgagcccagcgggcccagcgggcccagcgtgtgagccagctggagaag
attctagagaataacactcagtggctgctgaagctggagcagtccatccagatgaacttg
aggtcagacctggctcaggcccaacagcacacaatccagaaccagacgaccaccatgctg
gcactgggcgccaacctcatgaaccagaccatggctcagacccacaagctgactgctgtg
gaggcacaggtcctaaaccacacatctcgcgtgaagacccaaatgctggagagctcactg
tccaccaacaagctggagaggcagatgctgatgcagagccgcgagctgcagcggctgcag
ggccgcaacagggccctggagaccaggctgcaggcattggaggcacagcatcaggcccag
cttaacagcctccaagacaagagggaacaactgcaaagcctcctgggccatcagactggg
gccctggctaacctgaagcacagtctgcgagccctcagcagcaattccagctccctgcag
cagcagcagcagcagctgatggagctggtacagcgcctggtgcggattgtagcccaggac
cagcacccagtttccttaaagacgcctaagccgctgttccgggattgtgcagagatcaag
cgctctggagccaacaccagtggtgtctataccatccatggggccaacatgacaaagcct
ctcaaggtgttctgtgacatggagactgatggaggtggctggaccctcatccagcgcagg
gaggatggaagcttgaatttccagaggacttgggaggaatacaaagagggttttggtaat
gtggctagagaacactggctgggcaatgaggctgtgcacagcctcaccagcagaacggcc
tacttgctacgtgtggagctgcatgactgggaaggccaccagacctccatccagtatgag
aacttccagctgggcagcgagaggcagcggtacagcctctctgtgaatgacagcagcatc
tcagcaaggctcaagaacagcctggctcctcagggcaccaagttcagtaccaaagacatg
gacaatgataactgcatgtgcaaatgtgctcagatgctgtctggagggtggtggtttgac
gcctgtggcctctccaacctcaacggcatctactatccggttcatcaacacttgcataag
atcaatggcatccgctggcactacttccgaggccccagctactcactgcatggcacacgc
atgatgctgcggccaatgggtgcctga

KEGG   Rattus norvegicus (rat): 310643
Entry
310643            CDS       T01003                                 

Gene name
Efna4
Definition
(RefSeq) ephrin-A4 precursor
  KO
K05462  ephrin-A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    310643 (Efna4)
   04014 Ras signaling pathway
    310643 (Efna4)
   04015 Rap1 signaling pathway
    310643 (Efna4)
   04151 PI3K-Akt signaling pathway
    310643 (Efna4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    310643 (Efna4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    310643 (Efna4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    310643 (Efna4)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    310643 (Efna4)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   310643 (Efna4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   310643 (Efna4)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 310643
NCBI-ProteinID: NP_001101162
RGD: 1307808
Ensembl: ENSRNOG00000020588
UniProt: D3ZEN1
Position
2
AA seq 204 aa
MRLLPLLRTVLWAALLGSRLRGCSSLRHSIYWNSTNPRLLRGDAVVELGLNDYLDIFCPH
YESPGPPEGPETFALYIVDWSGYEACKAEGANAFQRWNCTLPFAPFVPVRFSEKIQRFTP
FPLGFEFLPGETYYYISVPTPESPGQCLRLQVSVCCKEDRSESAHPVGSPGESGTSGWRG
GHAPSPLSLLLLLLLPILRLLRVL
NT seq 615 nt   +upstreamnt  +downstreamnt
atgcggctgttgcccctgctgcggactgtgctctgggccgcgctgctcggctcgcgcctg
cgggggtgctccagcctccgccactctatctactggaactccactaaccccaggttgctt
cgaggagatgccgtggtggagctgggcctcaacgattacctagacatcttctgcccacat
tatgagagcccagggcccccagagggcccggaaacgtttgcattatacatagtggactgg
tcaggctacgaggcctgcaaggcagagggggcaaatgccttccagcgctggaattgcacg
ctaccttttgcgccttttgtccctgttcgattctccgaaaagattcagcgcttcacaccg
ttcccgctgggcttcgagttcttgcctggagagacttactactacatctcggtgccaact
ccggagagtcctggccagtgcctgagactccaggtgtctgtctgctgcaaggaggacaga
tccgagtcagctcatcctgtcgggagccctggagaaagtggcacatctgggtggcgggga
ggacacgcccccagccctctgtctctcctgctgttgctgctgctcccaatactccgtctt
ctgcgagttctgtga

KEGG   Rattus norvegicus (rat): 310738
Entry
310738            CDS       T01003                                 

Gene name
Ngf
Definition
(RefSeq) beta-nerve growth factor precursor
  KO
K02582  nerve growth factor, beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04722  Neurotrophin signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    310738 (Ngf)
   04014 Ras signaling pathway
    310738 (Ngf)
   04015 Rap1 signaling pathway
    310738 (Ngf)
   04020 Calcium signaling pathway
    310738 (Ngf)
   04151 PI3K-Akt signaling pathway
    310738 (Ngf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    310738 (Ngf)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    310738 (Ngf)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    310738 (Ngf)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    310738 (Ngf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    310738 (Ngf)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    310738 (Ngf)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Others
   310738 (Ngf)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   310738 (Ngf)
SSDB
Motif
Pfam: NGF Spaetzle NTF3_N
Other DBs
NCBI-GeneID: 310738
NCBI-ProteinID: NP_001263984
RGD: 1598328
Ensembl: ENSRNOG00000016571
UniProt: P25427
Position
2
AA seq 241 aa
MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPAEPIA
ARVTGQTRNITVDPKLFKKRRLRSPRVLFSTQPPPTSSDTLDLDFQAHGTISFNRTHRSK
RSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCR
APNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARR
G
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccatgttgttctacactctgatcacagcgtttttgatcggcgtacaggcagaaccg
tacacagatagcaatgtcccagagggagactctgtccctgaagcccactggactaaactt
cagcattcccttgacacagccctccgcagagcccgcagtgcccctgctgaaccaatagct
gcccgtgtgacagggcagacccgcaacatcactgtggaccccaaactgtttaagaaacgg
agactccgttcaccccgcgtgctgtttagcacccagcctccacccacctcttcggacact
ctggatttagacttccaggcccatggtacaatctccttcaacaggactcacaggagcaag
cgctcatccacccacccagtcttccacatgggggagttttcagtgtgtgacagtgtcagt
gtgtgggttggagataagaccacagccacggacatcaagggcaaggaggtgacagtgctg
ggcgaggtgaacattaacaacagtgtattcaaacagtatttttttgagaccaagtgccga
gccccgaatcctgtagagagtggatgccggggcattgactccaagcactggaactcatac
tgcaccacgactcacacctttgtcaaggcgttgacaacagacgacaaacaggctgcctgg
aggttcatcaggatagatacagcctgcgtgtgtgtgctcagcaggaaggctgcaagaaga
ggctga

KEGG   Rattus norvegicus (rat): 360457
Entry
360457            CDS       T01003                                 

Gene name
Vegfd
Definition
(RefSeq) vascular endothelial growth factor D precursor
  KO
K05449  vascular endothelial growth factor C/D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04668  TNF signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    360457 (Vegfd)
   04014 Ras signaling pathway
    360457 (Vegfd)
   04015 Rap1 signaling pathway
    360457 (Vegfd)
   04668 TNF signaling pathway
    360457 (Vegfd)
   04020 Calcium signaling pathway
    360457 (Vegfd)
   04151 PI3K-Akt signaling pathway
    360457 (Vegfd)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    360457 (Vegfd)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    360457 (Vegfd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    360457 (Vegfd)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    360457 (Vegfd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    360457 (Vegfd)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   360457 (Vegfd)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 360457
NCBI-ProteinID: NP_113949
RGD: 620695
Ensembl: ENSRNOG00000003587
UniProt: O35251
Position
X
AA seq 326 aa
MYGEWAAVNILMMSYVYLVQGFSSEHRAVKDVSFERSSRSVLERSEQQIRAASSLEELLQ
VAHSEDWKLWRCRLKLKSLASVDSRSTSHRSTRFAATFYDTETLKVIDEEWQRTQCSPRE
TCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEESVMCMNTSTSYISKQLFEISVPLTSV
PELVPVKIANHTGCKCLPTGPRHPYSIIRRSIQIPEEDQCPHSKKLCPVDMLWDNTKCKC
VLQDENPLPGTEDHSYLQEPALCGPHMMFDEDRCECVCKAPCPGDLIQHPENCSCFECKE
SLESCCQKHKMFHPDTCRSMVFSLSP
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtatggagagtgggccgcagtgaatattctcatgatgtcctatgtgtacctggtgcag
ggcttcagtagtgaacaccgagcagtgaaggatgtttcttttgagcgatcatcccggtct
gtgttggaacgttctgaacaacagatccgcgcggcttctagtttggaggagttgctgcaa
gtcgcacactctgaggactggaagctgtggcggtgccggttgaagcttaaaagtcttgcc
agtgtggactcgcgctcaacatcccatcgctccaccagatttgcggcaactttctatgat
actgaaacactaaaagttatagatgaagaatggcagaggacccaatgcagccctagagag
acatgcgtagaagtcgccagtgagctcgggaagacaaccaacacattcttcaagccccct
tgtgtaaatgtcttccggtgtggaggatgctgcaatgaagagagcgtgatgtgtatgaac
acaagcacctcctacatctccaaacagctctttgagatatcagtgcctctgacatcagtg
cccgagttagtgcctgttaaaattgccaaccatacgggttgtaagtgcttgcccacgggc
ccccggcatccctactcaattatcagaagatccattcagatcccagaagaagatcaatgt
cctcattccaagaaactctgtcctgttgacatgctgtgggataacaccaaatgtaaatgt
gttttacaagatgagaatccactgcctgggacagaagaccactcttacctccaggaaccc
gctctctgtggaccacacatgatgtttgatgaagatcgctgcgagtgtgtctgtaaagca
ccatgtcctggagatctcattcagcacccggaaaactgcagttgctttgaatgcaaagaa
agtctggaaagctgttgccaaaagcacaagatgtttcaccctgacacctgcagatcaatg
gtcttttcactgtccccttaa

KEGG   Rattus norvegicus (rat): 54250
Entry
54250             CDS       T01003                                 

Gene name
Fgf2
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04810  Regulation of actin cytoskeleton
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    54250 (Fgf2)
   04014 Ras signaling pathway
    54250 (Fgf2)
   04015 Rap1 signaling pathway
    54250 (Fgf2)
   04020 Calcium signaling pathway
    54250 (Fgf2)
   04151 PI3K-Akt signaling pathway
    54250 (Fgf2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    54250 (Fgf2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    54250 (Fgf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54250 (Fgf2)
   05205 Proteoglycans in cancer
    54250 (Fgf2)
   05207 Chemical carcinogenesis - receptor activation
    54250 (Fgf2)
  09162 Cancer: specific types
   05226 Gastric cancer
    54250 (Fgf2)
   05218 Melanoma
    54250 (Fgf2)
   05224 Breast cancer
    54250 (Fgf2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    54250 (Fgf2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    54250 (Fgf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    54250 (Fgf2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    54250 (Fgf2)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   54250 (Fgf2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   54250 (Fgf2)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 54250
NCBI-ProteinID: NP_062178
RGD: 2609
Ensembl: ENSRNOG00000017392
UniProt: P13109
Position
2
AA seq 154 aa
MAAGSITSLPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVK
LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYS
SWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 465 nt   +upstreamnt  +downstreamnt
atggctgccggcagcatcacttcgcttcccgcactgccggaggacggcggcggcgccttc
ccacccggccacttcaaggatcccaagcggctctactgcaagaacggcggcttcttcctg
cgcatccatccagacggccgcgtggacggcgtccgggagaagagcgacccacacgtcaaa
ctacagctccaagcagaagagagaggagttgtgtccatcaagggagtgtgtgcgaaccgg
tacctggctatgaaggaagatggacggctgctggcttctaagtgtgttacagaagagtgt
ttcttctttgaacgcctggagtccaataactacaacacttaccggtcacggaaatactcc
agttggtatgtggcactgaaacgaactgggcagtataaactcggatccaaaacggggcct
ggacagaaggccatactgtttcttccaatgtctgctaagagctga

KEGG   Rattus norvegicus (rat): 60427
Entry
60427             CDS       T01003                                 

Gene name
Kitlg
Definition
(RefSeq) kit ligand isoform 1 precursor
  KO
K05461  KIT ligand
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04640  Hematopoietic cell lineage
rno04916  Melanogenesis
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    60427 (Kitlg)
   04014 Ras signaling pathway
    60427 (Kitlg)
   04015 Rap1 signaling pathway
    60427 (Kitlg)
   04072 Phospholipase D signaling pathway
    60427 (Kitlg)
   04151 PI3K-Akt signaling pathway
    60427 (Kitlg)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    60427 (Kitlg)
  09152 Endocrine system
   04916 Melanogenesis
    60427 (Kitlg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    60427 (Kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    60427 (Kitlg)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   60427 (Kitlg)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 60427
NCBI-ProteinID: NP_068615
RGD: 3086
Ensembl: ENSRNOG00000005386
UniProt: P21581
Position
7
AA seq 273 aa
MKKTQTWIITCIYLQLLLFNPLVKTQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAG
MDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAP
KNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKK
QSSLTRAVENIQINEEDNEISMLQQKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaactcaggagatctgcaggaatcctgtgactgataatgtaaaagacatt
acaaaactggtggcgaatcttccaaatgactatatgataaccctcaactatgtcgccggg
atggatgttttgcctagtcattgttggttacgagatatggtaacacacttatcagtcagc
ttgactactcttctggacaagttttcaaatatttctgaaggcttgagtaattattccatc
atagacaaacttgggaaaatagtggatgacctcgtggcatgtatggaagaaaatgcacct
aagaatgtaaaagaatcactgaagaagccagaaactagaaactttactcctgaagaattc
tttagtattttcaatagatccattgatgccttcaaggacttcatggtggcatctgacact
agtgattgtgtgctctcttcaacattaggtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagttcccttaggaatgacagcagtagcagt
aataggaaagccgcaaagtcccctgaagacccaggcctacaatggacagcaatggcactg
ccggctctcatttcgcttgtaattggctttgcttttggagccttatactggaagaagaaa
cagtcaagtcttacaagggcagttgaaaatatacagattaatgaagaggataatgagata
agtatgttgcaacagaaagagagagagtttcaagaggtgtaa

KEGG   Rattus norvegicus (rat): 60464
Entry
60464             CDS       T01003                                 

Gene name
Fgf16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    60464 (Fgf16)
   04014 Ras signaling pathway
    60464 (Fgf16)
   04015 Rap1 signaling pathway
    60464 (Fgf16)
   04020 Calcium signaling pathway
    60464 (Fgf16)
   04151 PI3K-Akt signaling pathway
    60464 (Fgf16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    60464 (Fgf16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    60464 (Fgf16)
   05207 Chemical carcinogenesis - receptor activation
    60464 (Fgf16)
  09162 Cancer: specific types
   05226 Gastric cancer
    60464 (Fgf16)
   05218 Melanoma
    60464 (Fgf16)
   05224 Breast cancer
    60464 (Fgf16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    60464 (Fgf16)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    60464 (Fgf16)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   60464 (Fgf16)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   60464 (Fgf16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 60464
NCBI-ProteinID: NP_068639
RGD: 71052
Ensembl: ENSRNOG00000061530
Vega: OTTRNOG00000001765
UniProt: O54769
Position
X
AA seq 207 aa
MAEVGGVFASLDWDLQGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELFGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFRYR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcggaggtcgggggcgtctttgcctccttggactgggacctgcaaggcttctcctcc
tctctggggaacgtgcccttagctgactccccgggtttcctgaacgagcgcctgggccag
atcgaggggaagctgcagcgcggctcgcccacagacttcgcccacctgaaggggatcctg
cggcgccgccagctctactgccgcacgggcttccaccttgaaatcttccccaatggcacg
gtgcatggcacccgccacgaccacagccgcttcggaattctggaatttatcagcttggct
gtggggctgatcagcatccggggagtagactctggcctatacctaggaatgaatgagcga
ggagagctgtttggatcgaagaaactcacacgagaatgtgttttccgggaacagtttgaa
gaaaactggtacaacacctatgcatccaccttgtacaaacactcggactcggagagacag
tattatgtggccctgaataaagacggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttacccaggccagtagatccttctaagttgccctccatgtcc
agagacctcttccgctataggtaa

KEGG   Rattus norvegicus (rat): 60662
Entry
60662             CDS       T01003                                 

Gene name
Fgf5
Definition
(RefSeq) fibroblast growth factor 5 precursor
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    60662 (Fgf5)
   04014 Ras signaling pathway
    60662 (Fgf5)
   04015 Rap1 signaling pathway
    60662 (Fgf5)
   04020 Calcium signaling pathway
    60662 (Fgf5)
   04151 PI3K-Akt signaling pathway
    60662 (Fgf5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    60662 (Fgf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    60662 (Fgf5)
   05207 Chemical carcinogenesis - receptor activation
    60662 (Fgf5)
  09162 Cancer: specific types
   05226 Gastric cancer
    60662 (Fgf5)
   05218 Melanoma
    60662 (Fgf5)
   05224 Breast cancer
    60662 (Fgf5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    60662 (Fgf5)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    60662 (Fgf5)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   60662 (Fgf5)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   60662 (Fgf5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 60662
NCBI-ProteinID: NP_071547
RGD: 620129
Ensembl: ENSRNOG00000022631
UniProt: P48807
Position
14
AA seq 266 aa
MSLSLLFLIFCSHLILSAPAQGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFASSSASSP
VAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILE
IFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTE
KTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPRP
WKPKVPLSPSRRSPSPVKYRLKFRFG
NT seq 801 nt   +upstreamnt  +downstreamnt
atgagcctgtccttgctcttcctcatcttctgcagccacctgatcctcagcgctccggct
caaggggagaagcgtctcactcccgaagggcaacccgcgcctcctaggaacccgggagac
tccagcggcagccggggcagaagtagcgcgacgtttgcttcgtcttctgcctcttcccca
gtcgcagcttctccgggcagccaaggaagcggctcggagcacagcagtttccagtggagc
ccttcggggcgccggaccggcagcctgtactgcagagtgggcatcggtttccatctgcag
atctacccggatggcaaagtcaatggatcccacgaagccagtgtgttaagtattttggaa
atatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaattttta
gcgatgtcaaaaaaaggaaaactccatgcaagtgccaaatttacagatgactgtaagttc
agggagagattccaagaaaacagctataatacctatgcgtcagcgattcacagaactgaa
aagacaggccgggagtggtatgtggccctgaacaagagagggaaagccaaaagaggctgc
agcccacgggtcaaaccccagcacgtctccacccacttcctacccaggttcaagcagtcc
gagcaaccggaactttccttcaccgtcactgttccagaaaagaaaaagccacctaggccc
tggaaaccaaaggttcccctgtcgccatctcgtagaagccccagtccagtgaagtacaga
ctgaagtttcgcttcggatga

KEGG   Rattus norvegicus (rat): 66017
Entry
66017             CDS       T01003                                 

Gene name
Fgf20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    66017 (Fgf20)
   04014 Ras signaling pathway
    66017 (Fgf20)
   04015 Rap1 signaling pathway
    66017 (Fgf20)
   04020 Calcium signaling pathway
    66017 (Fgf20)
   04151 PI3K-Akt signaling pathway
    66017 (Fgf20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    66017 (Fgf20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    66017 (Fgf20)
   05207 Chemical carcinogenesis - receptor activation
    66017 (Fgf20)
  09162 Cancer: specific types
   05226 Gastric cancer
    66017 (Fgf20)
   05218 Melanoma
    66017 (Fgf20)
   05224 Breast cancer
    66017 (Fgf20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    66017 (Fgf20)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    66017 (Fgf20)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   66017 (Fgf20)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   66017 (Fgf20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 66017
NCBI-ProteinID: NP_076451
RGD: 71068
Ensembl: ENSRNOG00000000109
UniProt: Q9EST9
Position
16
AA seq 212 aa
MAPLTEVGAFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNGKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLVYTG
NT seq 639 nt   +upstreamnt  +downstreamnt
atggctcccttgaccgaagtcggtgccttcttgggcggcctggagggcttgggccagcag
gtggggtcgcacttcttgctgcctcctgcaggggagcgaccgccgctgctaggggagcgg
cggggcgcgttggagcggggcgcccgcggcgggccgggttccgtggagctggcgcacctg
cacggcatcctgcgccgccggcagctctactgccgcaccggcttccacctgcagatcctg
cccgacggcagtgtgcagggcacccggcaggatcacagcctcttcggtatcctggaattc
atcagtgtggcggtggggctggtcagtatcagaggtgtggacagcggcctgtaccttggc
atgaatggcaaaggagagctttatggctcagagaaattgacttctgaatgcatcttcagg
gaacaatttgaagagaactggtataatacctattcatccaacatatacaaacacggagac
acaggtcgcaggtattttgtagcacttaacaaagacgggactccaagggacggtgccagg
tccaaaagacaccaaaagtttacccattttttacccagaccagtggacccagagagagtc
ccagagttatacaaagacctactggtgtacactggatga

KEGG   Rattus norvegicus (rat): 66018
Entry
66018             CDS       T01003                                 

Gene name
Pdgfd
Definition
(RefSeq) platelet-derived growth factor D precursor
  KO
K05450  platelet derived growth factor C/D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04810  Regulation of actin cytoskeleton
rno05215  Prostate cancer
rno05218  Melanoma
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    66018 (Pdgfd)
   04014 Ras signaling pathway
    66018 (Pdgfd)
   04015 Rap1 signaling pathway
    66018 (Pdgfd)
   04020 Calcium signaling pathway
    66018 (Pdgfd)
   04072 Phospholipase D signaling pathway
    66018 (Pdgfd)
   04151 PI3K-Akt signaling pathway
    66018 (Pdgfd)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    66018 (Pdgfd)
   04540 Gap junction
    66018 (Pdgfd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    66018 (Pdgfd)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    66018 (Pdgfd)
  09162 Cancer: specific types
   05218 Melanoma
    66018 (Pdgfd)
   05215 Prostate cancer
    66018 (Pdgfd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    66018 (Pdgfd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    66018 (Pdgfd)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   66018 (Pdgfd)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 66018
NCBI-ProteinID: NP_076452
RGD: 621880
Ensembl: ENSRNOG00000029148
Vega: OTTRNOG00000001039
UniProt: Q9EQT1
Position
8
AA seq 370 aa
MHRLILVSILVCANFCCYRDTFATPQSASIKALRNANLRRDESNHLTDLYRRDENIRVTG
TGHVQSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDHQFGLEEAENDICRYDFVEVEDVS
ESSTVVRGRWCGHKEIPPRITSRTNQIKITFQSDDYFVAKPGFKIYYSFVEDFQPEAASE
INWESVTSSFSGVSYHSPSVMDSTLTADALDKAIAEFDTVEDLLKYFNPASWQDDLENLY
MDTPRYRGRSYHERKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQ
RCGGNCGCGTLNWKSCTCSSGKTVKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaccggctcatcttagtctccattcttgtgtgtgcgaacttttgctgctatcgggac
acttttgcgactccgcagagcgcatccatcaaagctttgcgcaatgccaacctcaggaga
gatgagagcaatcacctcacagacttgtaccggagagatgagaacattcgggtgacaggc
actggccacgtgcagagtcctcgcttccccaacagctacccgaggaacctgctcctgaca
tggcggctccattcccaggagaaaacacggatacagctggcctttgaccatcaatttgga
ctggaggaagcagaaaatgacatttgtaggtatgactttgtggaagttgaagatgtctca
gaaagcagcactgttgtcagaggaagatggtgtggccataaggagatccctccaaggata
acttcaagaacaaaccagattaaaatcacatttcagtctgatgactattttgtggcaaaa
cctggattcaagatttattattcatttgtggaagatttccaacctgaagcagcctcagag
atcaactgggaatcagtcacaagttctttctctggggtgtcctatcactctccatcagta
atggactccactctcactgccgatgccctggacaaagctattgcagaattcgatactgta
gaagatctgcttaagtacttcaatccagcgtcttggcaagatgatctggagaatttgtac
atggacacccctcgttatagaggcaggtcataccatgaacggaagtctaaagtggacctg
gacaggctcaatgatgatgtcaagcgttacagttgcactcccaggaatcactcggtgaat
ctcagggaggagttgaagctgaccaacgcagtcttcttcccacgatgcctccttgtgcag
cgctgtggtggcaactgtggttgcggaactctcaactggaagtcctgcacgtgcagctca
gggaagacagtgaagaagtatcatgaggtactgaagtttgagcctggacatttcaaaaga
aggggcaaagctaagaatatggctcttgtcgatatccagttggatcatcatgagcgatgt
gactgcatctgcagctcaagaccacctcgataa

KEGG   Rattus norvegicus (rat): 78965
Entry
78965             CDS       T01003                                 

Gene name
Csf1
Definition
(RefSeq) macrophage colony-stimulating factor 1 precursor
  KO
K05453  macrophage colony-stimulating factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04151  PI3K-Akt signaling pathway
rno04380  Osteoclast differentiation
rno04640  Hematopoietic cell lineage
rno04668  TNF signaling pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    78965 (Csf1)
   04014 Ras signaling pathway
    78965 (Csf1)
   04015 Rap1 signaling pathway
    78965 (Csf1)
   04668 TNF signaling pathway
    78965 (Csf1)
   04151 PI3K-Akt signaling pathway
    78965 (Csf1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    78965 (Csf1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    78965 (Csf1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    78965 (Csf1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    78965 (Csf1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    78965 (Csf1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    78965 (Csf1)
   05022 Pathways of neurodegeneration - multiple diseases
    78965 (Csf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    78965 (Csf1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  CSF and other factors
   78965 (Csf1)
SSDB
Motif
Pfam: CSF-1 DUF6479
Other DBs
NCBI-GeneID: 78965
NCBI-ProteinID: NP_076471
RGD: 621063
Ensembl: ENSRNOG00000018659
UniProt: Q6GMN4
Position
2
AA seq 566 aa
MTARGAAGRCPSSTWMGSRLLLVCLLVSRSVAEVSEHCSHMIGNGHLQILQQLIDSQMET
ACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNS
CFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSR
DVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPL
RIEDPGSAKQRPPRSTCQTLESTEQPNHEDPQPHPSAGAPIPGVEDIIESSMGTNWVLEE
ASGEASEGFLTQERKFSPSNPVGGSIQAETDRPWARSASSPFPKLTEDQQPTNITDTPLT
EVNPMRPTGQTLNNTPEKTDGSSTLREDQQEPRSPHFATLNPQRVGNSATPYAKLLPPKS
HSWGIVLPLGELEGKKSTRDRRSPAELKGGPASEGAARPVAQSTRDRRSPAELKGGPASE
GAARPVARFNSIPLTDTGSSIQDPQTSAFVFWVLGIILVLLAVGGLLFYSWKRRSHRDPR
TLDSSVGRPEGSSLAQDEDRQVELPV
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgaccgcgcggggcgccgcggggcgctgcccttcttcgacatggatgggctcccggctg
ctgctggtctgtctcctcgtgagcaggagtgttgccgaggtgtcggagcactgtagccac
atgattgggaatggacacctacagattttgcagcagttgatcgacagccaaatggagact
gcatgcctgatcgaatataaatttgtagaccaggaacagctggacgatcccgtttgctac
ctaaagaaggcctttgttttggtacaagtcataatcgaggaaaccatgcgctttaaagac
aacacccccaacgccaacgccaccgagaggctacaggaactctctatgaaactgaacagc
tgctttatcaaggactataaggaacagaacgaggcctgtgtccaaacttacaaagagagt
cctctccggttgctggagaaaatcaagaatttctttaacgaaacaaagaatttccttgaa
aaggactggaatatttttagcaagaactgcaatgacagccttgctaaatgctctagcaga
gatgtggtgaccaagcctgattgcaactgcctgtaccctaaagccacccctagcagcgac
ctggcctctgcctcccctcaccagccccctgccccctccatggcccctctggctgacttg
gcttgggatgattctcagaggacagagggaagctccctcttgcccagtgatctgcctctt
cgcatagaggacccaggcagtgctaagcagcgaccgcccaggagtacctgccagaccctc
gagtcaacagagcaaccaaatcacgaggacccacaacctcatccttctgcgggggccccc
atccctggggtggaagacattattgaatcttcaatgggcactaactgggtcttagaagaa
gcttctggagaggctagtgagggatttttgacccaggaaaggaagttttccccctccaat
cctgtagggggcagcatccaggcagagactgacagaccctgggcccgctcagcatcttct
ccattccctaaattaacagaggatcaacagccaacgaatataacagacaccccgttgaca
gaggtgaaccctatgagacccactggccagacactgaataatactcctgagaagacggat
ggttcatctacactgcgcgaagaccagcaggagccacgctctccccattttgccacactg
aatccccaacgagtcggcaactcagccaccccctatgctaagttactgcctcccaaaagc
cactcttggggcattgtactgccccttggggagctcgagggcaagaaaagtactagagat
cgaaggagccccgcagagctgaaaggaggaccagcaagtgagggggcagccaggcctgtg
gcccaaagtactagagatcgaaggagccccgcagagctgaaaggaggaccagcaagtgag
ggggcagccaggcctgtggcccgttttaattccattcctttgaccgacacaggctcttct
attcaggatccccagacctctgcgtttgtcttctgggtgctaggcatcatcctagtcttg
ctggctgtcgggggcctcctgttctacagttggaagcggaggagccatcgagaccctcgg
acattggattcttctgtggggcgaccagagggcagctccctggcccaggatgaggacaga
caggtggaactgccagtgtag

KEGG   Rattus norvegicus (rat): 79429
Entry
79429             CDS       T01003                                 

Gene name
Pdgfc
Definition
(RefSeq) platelet-derived growth factor C precursor
  KO
K05450  platelet derived growth factor C/D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04810  Regulation of actin cytoskeleton
rno05215  Prostate cancer
rno05218  Melanoma
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    79429 (Pdgfc)
   04014 Ras signaling pathway
    79429 (Pdgfc)
   04015 Rap1 signaling pathway
    79429 (Pdgfc)
   04020 Calcium signaling pathway
    79429 (Pdgfc)
   04072 Phospholipase D signaling pathway
    79429 (Pdgfc)
   04151 PI3K-Akt signaling pathway
    79429 (Pdgfc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    79429 (Pdgfc)
   04540 Gap junction
    79429 (Pdgfc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    79429 (Pdgfc)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    79429 (Pdgfc)
  09162 Cancer: specific types
   05218 Melanoma
    79429 (Pdgfc)
   05215 Prostate cancer
    79429 (Pdgfc)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    79429 (Pdgfc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    79429 (Pdgfc)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   79429 (Pdgfc)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 79429
NCBI-ProteinID: NP_112607
RGD: 68410
Ensembl: ENSRNOG00000010695
UniProt: Q9EQX6
Position
2
AA seq 345 aa
MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVVTISGNGSIHS
PKFPHTYPRNTVLVWRLVAVDENVRIQLTFDERFGLEDPEDDLCKYDFVEVEEPSDGSVL
GRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSA
LSLDLLNNAVTAFSTVEELIRFLEPDRWQIDLDSLYKPTWPLLGKAFLYGKKSKAVNLNL
LKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRK
VTKKYHEVLQLRPKIGVKGLHKSLTDVALEHHEECDCVCRGNTEG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcctcggcctcctcctgctgacatctgccctggccggccagagaaccgggact
cgggctgagtccaacctgagcagcaagttgcagctctccagcgacaaggagcagaacgga
gtgcaagatccccggcatgagagagttgtcactatatctggtaatgggagcatccacagc
ccgaagtttcctcatacctacccaagaaatacggtgctggtctggagattagtggcagta
gatgaaaatgtgcggatccagctgacatttgatgagagatttgggctggaagacccagag
gacgatctatgcaagtatgattttgtagaagttgaggagcccagtgatggaagtgtatta
ggacgctggtgtggttctgggactgtgccaggaaagcagacttctaaaggaaatcatatc
aggataagatttgtatctgatgagtatttcccatctgaacccggattctgcatccactac
agtattatcatgccacaagtcacagaaactacgagtccttcagtgttgcccccttcagct
ttgtcattggacctgctcaataatgctgtgactgccttcagtactgtggaagagctgatt
cggttcctagagccagatcgatggcagatagacttggacagcctctacaagccaacatgg
ccgcttttgggcaaagctttcctgtatgggaaaaaaagcaaagcggtgaatctgaacctt
ctcaaagaagaggtaaaactttacagctgcacaccccggaacttctctgtgtccatacgg
gaagagctaaagaggacagacaccatattctggccaggttgtctcctggtcaagcgctgt
ggaggaaattgtgcctgttgcctccataattgcaatgaatgtcagtgtgtcccacgtaaa
gttacaaaaaagtaccatgaggtccttcagttgagaccaaaaattggagtcaagggattg
cataagtcgctcaccgatgtggccctggaacaccatgaggaatgtgactgtgtgtgtaga
ggaaacacagaagggtaa

KEGG   Rattus norvegicus (rat): 83785
Entry
83785             CDS       T01003                                 

Gene name
Vegfa
Definition
(RefSeq) vascular endothelial growth factor A isoform 6 precursor
  KO
K05448  vascular endothelial growth factor A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05219  Bladder cancer
rno05323  Rheumatoid arthritis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    83785 (Vegfa)
   04014 Ras signaling pathway
    83785 (Vegfa)
   04015 Rap1 signaling pathway
    83785 (Vegfa)
   04370 VEGF signaling pathway
    83785 (Vegfa)
   04066 HIF-1 signaling pathway
    83785 (Vegfa)
   04020 Calcium signaling pathway
    83785 (Vegfa)
   04151 PI3K-Akt signaling pathway
    83785 (Vegfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    83785 (Vegfa)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    83785 (Vegfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83785 (Vegfa)
   05206 MicroRNAs in cancer
    83785 (Vegfa)
   05205 Proteoglycans in cancer
    83785 (Vegfa)
   05207 Chemical carcinogenesis - receptor activation
    83785 (Vegfa)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    83785 (Vegfa)
   05211 Renal cell carcinoma
    83785 (Vegfa)
   05219 Bladder cancer
    83785 (Vegfa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    83785 (Vegfa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    83785 (Vegfa)
   05165 Human papillomavirus infection
    83785 (Vegfa)
  09163 Immune disease
   05323 Rheumatoid arthritis
    83785 (Vegfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    83785 (Vegfa)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    83785 (Vegfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    83785 (Vegfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    83785 (Vegfa)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    83785 (Vegfa)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   83785 (Vegfa)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   83785 (Vegfa)
SSDB
Motif
Pfam: VEGF_C PDGF Cnd1_N
Other DBs
NCBI-GeneID: 83785
NCBI-ProteinID: NP_001274036
RGD: 619991
Ensembl: ENSRNOG00000019598
UniProt: P16612 B5DEK7
Position
9
AA seq 214 aa
MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMS
FLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQD
PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcactggaccctggctttactgctgtacctccaccat
gccaagtggtcccaggctgcacccacgacagaaggggagcagaaagcccatgaagtggtg
aagttcatggacgtctaccagcgcagctattgccgtccaattgagaccctggtggacatc
ttccaggagtaccccgatgagatagagtatatcttcaagccgtcctgtgtgcccctaatg
cggtgtgcgggctgctgcaatgatgaagccctggagtgcgtgcccacgtcggagagcaac
gtcactatgcagatcatgcggatcaaacctcaccaaagccagcacataggagagatgagc
ttcctgcagcatagcagatgtgaatgcagaccaaagaaagatagaacaaagccagaaaaa
aaatcagttcgaggaaagggaaagggtcaaaaacgaaagcgcaagaaatcccggtttaaa
tcctggagcgttcactgtgagccttgttcagagcggagaaagcatttgtttgtccaagat
ccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagctt
gagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

KEGG   Rattus norvegicus (rat): 84358
Entry
84358             CDS       T01003                                 

Gene name
Efna2
Definition
(RefSeq) ephrin-A2 precursor
  KO
K05462  ephrin-A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    84358 (Efna2)
   04014 Ras signaling pathway
    84358 (Efna2)
   04015 Rap1 signaling pathway
    84358 (Efna2)
   04151 PI3K-Akt signaling pathway
    84358 (Efna2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    84358 (Efna2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    84358 (Efna2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    84358 (Efna2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    84358 (Efna2)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   84358 (Efna2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   84358 (Efna2)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 84358
NCBI-ProteinID: NP_001162141
RGD: 620389
Ensembl: ENSRNOG00000016203
UniProt: F1MA19
Position
7
AA seq 209 aa
MAPAQRPLLPLLLLLLPLRARNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVS
INDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPL
KFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPI
FTSNSSCSGLGGCHLFLTTVPVLWSLLGS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgcccgcgcagcgcccgctgctgccgctgctgctgttgctgctgccgctgcgtgcg
cgcaacgaggacccggcccgtgccaacgctgaccgctacgcagtctactggaaccgcagc
aaccccaggtttcaggtgagcgctgtgggtgatggcggcggctacaccgtggaggtcagc
atcaatgactacctggacatctattgcccgcactatggggcgccactgcccccggcagag
cgcatggaacggtacatcctatacatggtgaacggcgagggccatgcctcctgtgaccac
cggcagcgaggcttcaagcgctgggaatgcaaccggcccgctgcgcctgggggacccctc
aaattctccgagaagttccaactcttcacccccttttccctgggctttgagttccgacct
ggacacgagtactactacatctctgccacaccccccaaccttgtggaccgaccctgcctg
cggctgaaagtttacgtgcgtccaaccaatgagaccctgtatgaggccccagagcccatc
ttcaccagtaacagctcctgcagcggcctgggtggctgccacctcttcctcactacagtc
cctgtgctgtggtccctactgggctcctag

KEGG   Rattus norvegicus (rat): 89805
Entry
89805             CDS       T01003                                 

Gene name
Angpt2
Definition
(RefSeq) angiopoietin-2 precursor
  KO
K05466  angiopoietin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    89805 (Angpt2)
   04014 Ras signaling pathway
    89805 (Angpt2)
   04015 Rap1 signaling pathway
    89805 (Angpt2)
   04066 HIF-1 signaling pathway
    89805 (Angpt2)
   04151 PI3K-Akt signaling pathway
    89805 (Angpt2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    89805 (Angpt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    89805 (Angpt2)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   89805 (Angpt2)
SSDB
Motif
Pfam: Fibrinogen_C Spc29 CENP-H
Other DBs
NCBI-GeneID: 89805
NCBI-ProteinID: NP_604449
RGD: 621861
Ensembl: ENSRNOG00000016696
UniProt: O35462
Position
16
AA seq 496 aa
MWQIVFLTFGCDLVLASAYNNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPY
MSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQ
TAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSE
INKLQDKNSFLEKKVLDMEDKHSVQLQSMKEQKDQLQVLVSKQSSVIDELEKKLVTATVN
NSVLQKQQHDLMETVNSLLTMMSSPDYKSSVAVPKEEKTTFRDCAEIFKSGLTTSGIYTL
TFPNSTEEVKAYCDMDMGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFV
SQLTSGHRYVLKIQLKDWEGSEAHSLYEHFYLSGEESNYRIHLTGLTGTAGKISSISQPG
SDFSTKDSDNDKCICKCSQMLTGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGS
GYSLKATTMMIRPADF
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgtggcagattgttttcctaacttttggctgtgatcttgtcttggcctcagcctacaat
aactttaggaagagcgtggacagcacgggcaggaggcagtaccaggtccagaacggaccc
tgcagctacacattcctgctgccggagaccgacagctgccgatcttcctccagcccctac
atgtctaacgccgtgcagagggatgcacccctcgactacgacgactcagtgcaaaggctg
caggtgctggagaacattctagagaacaacacacagtggctgatgaagctggagaactac
atccaggacaacatgaagaaggagatggtggagatccagcagaatgtggtgcagaaccag
acggctgtgatgatcgagattggaaccagtttgctcaaccagacggcggcacaaactcgg
aaactgactgatgtggaagcccaagtactaaaccagacgacaagactcgagttgcagctt
cttcaacattctatttctaccaacaaattggaaaagcagattttggaccagaccagtgaa
ataaacaaactacaagataagaacagcttcctagaaaagaaagtgctggacatggaggac
aagcacagtgtgcagctgcagtccatgaaggagcagaaggaccagcttcaggtgctggtg
tccaagcagagctccgtcatcgatgagctggagaagaagctggtgacggccacagtcaac
aactcagtccttcagaagcagcagcatgatctaatggagacggtcaacagcttgctgacc
atgatgtcatcgcccgactataagagctctgttgctgtccctaaagaagagaaaaccacc
ttcagagactgtgcagaaatcttcaagtcaggactcaccaccagtggcatctacacgctg
accttccccaactccacagaggaggtcaaggcctactgtgacatggacatgggtggagga
gggtggacggtcatccaacaccgggaagatggcagcgttgacttccagagaacgtggaaa
gagtacaaagagggcttcgggagccctctgggagagtattggctgggcaacgagtttgtc
tcccagctgaccagtgggcatcgctacgtgctgaagatccagctgaaggactgggaaggc
agcgaggcacactctctgtatgagcacttctacctgtccggcgaggagtccaactacagg
attcaccttacaggactcacaggcacggcgggcaaaatcagtagcatcagccaaccagga
agtgattttagcacaaaggattcggacaatgacaaatgcatctgcaagtgttcccagatg
ctcacaggaggctggtggttcgacgcatgtggtccttccaacttgaatggacagtactac
ccacaaaagcagaatacgaataagttcaacggtatcaagtggtactactggaaggggtcc
ggttactcgctcaaggccacgaccatgatgatccggccagcagatttctaa

KEGG   Rattus norvegicus (rat): 89807
Entry
89807             CDS       T01003                                 

Gene name
Angpt1
Definition
(RefSeq) angiopoietin-1 precursor
  KO
K05465  angiopoietin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    89807 (Angpt1)
   04014 Ras signaling pathway
    89807 (Angpt1)
   04015 Rap1 signaling pathway
    89807 (Angpt1)
   04066 HIF-1 signaling pathway
    89807 (Angpt1)
   04151 PI3K-Akt signaling pathway
    89807 (Angpt1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    89807 (Angpt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    89807 (Angpt1)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   89807 (Angpt1)
SSDB
Motif
Pfam: Fibrinogen_C
Other DBs
NCBI-GeneID: 89807
NCBI-ProteinID: NP_445998
RGD: 628896
Ensembl: ENSRNOG00000005854
UniProt: O35460
Position
7
AA seq 497 aa
MTVFLSFAFFAAILTHIGCSNQRRSPENGGRRYNRIQHGQCAYTFILPEHDGNCRESATE
QYNTNALQRDAPHVETDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIQEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTFIIQELEKQLSRA
TNNNSVLQKQQLELMDTVHNLVSLCTKEVLLKGGKREEEKPFRDCADVYQAGFNKSGIYT
IYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEF
IFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILH
GADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKG
PSYSLRSTTMMIRPLDF
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacagttttcctttcctttgcattcttcgctgccattctgactcacatagggtgcagc
aaccagcgccggagtccagaaaacggagggagaagatataaccgaattcaacatgggcaa
tgtgcctacactttcattcttccagaacacgacgggaactgccgtgagagtgcgacagag
cagtacaacaccaacgctctgcaaagggatgctccacacgtggagacggatttctcttcc
cagaaacttcagcatctggagcatgtgatggaaaattatactcagtggctgcaaaaactt
gagaattacattgtggaaaatatgaagtcggagatggcccagatacaacagaatgcggtt
caaaaccacacggccaccatgctggagataggaaccagcctcttgtctcagactgcagag
cagacccgaaagctcacagatgtggagacccaggtactaaatcaaacatcccgtcttgaa
atccaactgctggagaattcattatcaacatacaagctagagaaacagcttctccaacag
acaaatgaaattctgaagattcaggaaaaaaacagtttattagagcataaaatcctagaa
atggagggaaaacacaaggaagagctggacaccttgaaggaggagaaagaaaaccttcaa
ggcttggttactcgtcagacattcatcatccaagaattggagaagcaacttagcagagct
accaacaacaacagtgttctgcagaagcaacaactggagctcatggacacagtccataac
cttgtcagcctttgcacaaaagaagttttgctaaagggaggaaaaagagaagaagagaaa
ccatttcgagactgtgcagatgtatatcaagctggttttaataagagtggaatctacact
atttattttaataatatgccagaacccaaaaaggtattttgcaatatggatgtgaatgga
ggaggatggacagtaatacaacaccgtgaggatggaagcctagatttccagaggggctgg
aaggagtataaaatgggttttgggaatccctctggtgaatattggcttgggaacgagttc
atttttgcaataaccagtcagaggcagtacatgctgaggatcgagctgatggactgggaa
gggaaccgagcctactcacagtacgacagattccacataggaaacgagaagcagaactac
aggttatatttaaagggtcacacggggacagcaggcaaacagagcagcttgatcttacat
ggtgctgatttcagcacaaaggacgctgataacgacaactgtatgtgcaaatgcgccctt
atgctaacaggaggttggtggtttgatgcctgtggcccttccaatctaaacggaatgttc
tacactgcggggcaaaaccatggaaaactgaatgggataaagtggcactacttcaaagga
cccagttactccttacgttccacaaccatgatgatccggcccttggacttctga

KEGG   Rattus norvegicus (rat): 89811
Entry
89811             CDS       T01003                                 

Gene name
Vegfb
Definition
(RefSeq) vascular endothelial growth factor B precursor
  KO
K16858  vascular endothelial growth factor B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    89811 (Vegfb)
   04014 Ras signaling pathway
    89811 (Vegfb)
   04015 Rap1 signaling pathway
    89811 (Vegfb)
   04020 Calcium signaling pathway
    89811 (Vegfb)
   04151 PI3K-Akt signaling pathway
    89811 (Vegfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    89811 (Vegfb)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    89811 (Vegfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    89811 (Vegfb)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    89811 (Vegfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    89811 (Vegfb)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   89811 (Vegfb)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 89811
NCBI-ProteinID: NP_446001
RGD: 619799
Ensembl: ENSRNOG00000021156
UniProt: O35485
Position
1
AA seq 186 aa
MSPLLRRLLLVALLQLACTQAPVSQFDGPSHQKKVVSWIDVYARATCQPREVVVPLSMEL
MGNVVKQLVPSCVTVQRCGGCCPDDGLECVPIGQHQVRMQILMIQYPSSQLGEMSLEEHS
QCECRPKRKESAVKPDSPRTLCPRCTQRRQRPDPRTCRCRCRRRRFLHCQGRGLELNPDT
CRSSET
NT seq 561 nt   +upstreamnt  +downstreamnt
atgagccccctgctccgtcgcttgctgcttgttgcgctgctgcagctggcctgtacccag
gcccctgtgtcccagtttgatggccccagccaccagaagaaagtggtgtcatggatagat
gtttatgcacgtgccacatgccagcccagggaggtggtggtacctctgagcatggaactc
atgggtaatgtggtcaaacaactcgtgcccagctgtgtgactgtgcagcgctgtggtggc
tgctgtcctgacgatggcctggagtgtgtgcccattgggcaacaccaagtccgaatgcag
atcctcatgatccagtacccgagcagtcagctgggggagatgtccctggaagaacacagc
caatgtgaatgcagaccaaaaagaaaggagagtgctgtgaagccagacagccccaggacc
ctctgcccacgctgcacccagcgccgtcagcgccctgatccccggacctgccgttgccgc
tgcagacgccgccgcttcctccattgccaagggcggggcttagagctcaacccagatacc
tgcagatcatcagaaacttag

KEGG   Rattus norvegicus (rat): 94203
Entry
94203             CDS       T01003                                 

Gene name
Pgf
Definition
(RefSeq) placenta growth factor precursor
  KO
K16859  placenta growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    94203 (Pgf)
   04014 Ras signaling pathway
    94203 (Pgf)
   04015 Rap1 signaling pathway
    94203 (Pgf)
   04151 PI3K-Akt signaling pathway
    94203 (Pgf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    94203 (Pgf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    94203 (Pgf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    94203 (Pgf)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   94203 (Pgf)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 94203
NCBI-ProteinID: NP_446047
RGD: 619850
Ensembl: ENSRNOG00000005650
UniProt: Q63434
Position
6
AA seq 158 aa
MLAMKLFTCFLQVLAGLAVHSQGALSAGNNSTEMEVVPFNEVWGRSYCRPMEKLVYIADE
HPNEVSHIFSPSCVLLSRCSGCCGDEGLHCVALKTANITMQILKIPPNRDPHSYVEMTFS
QDVLCECRPILETTKAERRKTKGKRKQSKTPQTEEPHL
NT seq 477 nt   +upstreamnt  +downstreamnt
atgctggccatgaagctgttcacttgcttcttgcaggtcctagctgggttggctgtgcac
tcccagggggccctgtctgctgggaacaactcaacagaaatggaagtggtgcctttcaat
gaagtgtggggccgcagctactgccggccaatggagaagctggtgtacattgcagatgaa
caccctaatgaagtgtctcatatattcagtccgtcatgtgtccttctgagtcgctgtagt
ggctgctgtggtgacgagggtctgcactgtgtggcgctaaagacagccaacatcactatg
cagatcttaaagattccccccaatcgggatccacattcctacgtggagatgacattctct
caggatgtgctctgcgaatgcaggcctattctggagacgacaaaggcagaaaggaggaaa
accaaggggaagaggaagcaaagcaaaaccccacagactgaggaaccccacctgtga

KEGG   Rattus norvegicus (rat): 94268
Entry
94268             CDS       T01003                                 

Gene name
Efna1
Definition
(RefSeq) ephrin-A1 precursor
  KO
K05462  ephrin-A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    94268 (Efna1)
   04014 Ras signaling pathway
    94268 (Efna1)
   04015 Rap1 signaling pathway
    94268 (Efna1)
   04151 PI3K-Akt signaling pathway
    94268 (Efna1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    94268 (Efna1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    94268 (Efna1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    94268 (Efna1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    94268 (Efna1)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   94268 (Efna1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   94268 (Efna1)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 94268
NCBI-ProteinID: NP_446051
RGD: 620388
Ensembl: ENSRNOG00000020573
UniProt: P97553
Position
2
AA seq 205 aa
MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVA
DAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEF
KEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIG
HSAAPRLFPLVWAVLLLPLLLLQTQ
NT seq 618 nt   +upstreamnt  +downstreamnt
atggagttcctttgggcccctctcttgggtctgtgctgcagtctggccgctgctgaccgc
cacatcgtcttctggaacagttcaaatcccaagttccgagaggaggactacaccgtgcac
gtgcagctgaatgactatctggacatcatctgcccacattacgaggacgactctgtggca
gatgctgccatggagagatacacgctgtacatggtggaacaccaggagtatgtgacatgc
gagccccagtccaaggaccaggttcgctggaagtgcaaccagcccagtgccaagcacggc
ccggagaagctgtctgagaaattccagcgcttcacgcctttcaccttgggcaaggagttc
aaggaaggacacagctactactacatctccaaacctatctaccatcaggaaacccagtgc
ctgaagttgaaggtgactgtcaatggcaaaatcactcacagcccccacgcccatgccaac
ccacaggagaagagactccaagcagatgacccggaagtgcaggttttgcacagcattggt
cacagcgccgccccccgcctcttcccattggtctgggcagtattgctcctaccactgctg
ctgctgcaaactcagtga

DBGET integrated database retrieval system