KEGG   Rattus norvegicus (rat): 114211
Entry
114211            CDS       T01003                                 

Gene name
Mtnr1a
Definition
(RefSeq) melatonin receptor type 1A
  KO
K04285  melatonin receptor type 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114211 (Mtnr1a)
 09150 Organismal Systems
  09159 Environmental adaptation
   04713 Circadian entrainment
    114211 (Mtnr1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    114211 (Mtnr1a)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Melatonin
    114211 (Mtnr1a)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4 TctB DUF4233
Other DBs
NCBI-GeneID: 114211
NCBI-ProteinID: NP_446128
RGD: 620797
Ensembl: ENSRNOG00000028744
UniProt: B7X945
Position
16
AA seq 353 aa
MKGNVSELLNASQQAPGGGEEIRSRPSWLASTLAFILIFTIVVDILGNLLVILSVYRNKK
LRNAGNIFVVSLAVADLVVAIYPFPLALTSILNNGWNLGYLHCQVSAFLMGLSVIGSVFN
ITGIAMNRYCYICHSLKYDRIYSNKNSLCYVFLIWTLTLIAIMPNLQTGTLQYDPRIYSC
TFTQSVSSAYTIALVVFHFVVPMIIVTFCYLRIWILVLQVRRRVKPDSKPKLKPQDFRNF
VTMFVVFVLFALCWAPLNFIGLIVASDPAAMAPRIPEWLFVASYYLAYFNSCLNAIIYGL
LNQNFRKEYKRIIISLCTAKMFFVDSSNDAADKIKCKPSPLITNNNLIKVDSV
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgaagggcaatgtcagcgagcttctcaacgcctctcagcaggctccaggcggcggggag
gaaataagatcgcggccgtcgtggctggcctctacactggccttcatcctcatctttact
atcgtggtggacatcctgggcaacctgctggtcatcctgtctgtgtatcgcaacaagaag
ctcaggaacgcagggaatatatttgtggtgagtttagctgtggcagacctcgtggtggct
atttacccatttcccttggcgctgacgtctatacttaacaatggatggaacctgggatat
ctgcattgtcaagttagtgccttcctaatgggcctgagtgtcattggctcggtattcaac
atcaccgggatcgctatgaaccgctactgctacatttgccacagtctcaagtatgatagg
atatacagtaacaagaattccctgtgctacgtgttcctgatatggacactgacactcata
gccatcatgcccaacctgcaaaccggaactctccagtacgacccccggatctactcctgt
accttcacccagtccgtcagctcggcgtacacgattgccctggtggttttccatttcgta
gttccaatgattattgtcactttctgctacttaaggatatggatcctggttcttcaggtc
agacggagggtgaaaccggacagcaaacccaaactgaagccgcaggacttcaggaacttt
gtcaccatgtttgtagtttttgtactttttgccctgtgctgggccccactcaacttcata
ggtcttattgtggcctcagatccggccgccatggcccccaggatcccggagtggctcttc
gtggctagttactacctggcgtatttcaacagctgcctcaacgcaatcatatacggacta
ctgaaccaaaatttcagaaaggagtacaagaggattatcatctcactgtgcacagctaag
atgttctttgtggacagttcaaatgatgcagcagataagattaaatgtaagccctctcca
ctaataaccaataataatttaataaaggtggactctgtttaa

DBGET integrated database retrieval system